KEGG   Pseudomonas aeruginosa PAO1: PA3383Help
Entry
PA3383            CDS       T00035                                 

Definition
(RefSeq) phosphonate ABC transporter substrate-binding protein
  KO
K02044  phosphonate transport system substrate-binding protein
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:pae00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PA3383
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pae02000]
    PA3383
Transporters [BR:pae02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    PA3383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphonate-bd YukC
Motif
Other DBs
NCBI-GeneID: 880002
NCBI-ProteinID: NP_252073
UniProt: Q9HYL8
Structure
PDB: 

Position
complement(3789093..3790097)
Genome map
AA seq 334 aa AA seqDB search
MLKRFSRVLAASALLAGSLAGMAHADQPVINFGIISTESSQNLKSIWEPFLKDMSQQTGY
QVKAFFAPDYAGIIQGMRFDKVDIAWYGNKAAMEAVDRAHGEIFAQTVAASGAPGYWSLL
IANKDSKIDSLEDMLANAKSLTFGNGDPNSTSGYLVPGYYVFAKNNVDPVKAFKRTLNSS
HEVNALAVANKQVDVATFNTEGMERLELTQPEKARQLKVIWKSPLIPGDPLVWRNNLSDE
QKNKLRDFFFKYGANAEQKKVLADLQWSKFQPSDDDQLLPIRQLELFKQRTDVANNANLG
AEEKAAKLKALDEELAKLEKRMAEREQKTAANAG
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaacgcttcagtcgtgtgctcgcggcttccgccctgctcgccggctcccttgcc
gggatggcgcacgccgaccagccggtgatcaatttcgggatcatctccaccgagtcgtcg
cagaacctcaagagcatctgggaacccttcctcaaggacatgagccagcagaccggctac
caggtgaaggccttcttcgcccccgactacgccgggatcatccaaggcatgcgtttcgac
aaggtcgacatcgcctggtacggcaacaaggccgccatggaagcggtggatcgcgcccac
ggcgagatcttcgcccagaccgtcgccgccagtggcgcgccgggctactggagcctgctg
atcgccaacaaggacagcaagatcgacagcctcgaggacatgttggcgaacgccaagagc
ctgaccttcggcaacggcgatccgaactccacgtccggctacctggtgcccggctactac
gtgttcgccaagaacaacgtcgacccggtcaaggccttcaagcgcaccctcaattccagc
catgaggtcaacgcactggcggtggccaacaagcaggtcgacgtcgccaccttcaatacc
gagggcatggagcgcctggaattgacccagccggagaaggccaggcagctcaaggtgatc
tggaagtcgccgctgatcccgggcgacccgctggtgtggcgcaacaacctgagcgacgag
cagaagaacaagctgcgcgacttcttcttcaagtacggcgccaacgccgagcagaagaag
gtcctcgccgacctgcaatggtcgaagttccagccctccgacgacgaccagttgctgccg
atccgccagctcgagctgttcaagcagcgcaccgacgtggcgaacaacgccaacctcggc
gccgaggagaaggccgccaagctgaaggccctcgacgaggagctggccaagctggagaaa
cgcatggccgagcgcgagcagaaaaccgccgccaacgccggctga

DBGET integrated database retrieval system