KEGG   Pseudomonas aeruginosa PAO1: PA3385Help
Entry
PA3385            CDS       T00035                                 

Gene name
amrZ
Definition
(RefSeq) alginate and motility regulator Z
Organism
pae  Pseudomonas aeruginosa PAO1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arc HicB
Motif
Other DBs
NCBI-GeneID: 878714
NCBI-ProteinID: NP_252075
UniProt: G3XCY4
Structure
PDB: 

Position
3791347..3791673
Genome map
AA seq 108 aa AA seqDB search
MRPLKQATPTYSSRTADKFVVRLPEGMREQIAEVARSHHRSMNSEIIARLEQSLLQEGAL
QDNLGVRLDSPELSLHERELLQRFRQLTHRQQNALVALIAHDAELAQA
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccactgaaacaggcaactcctacctactccagccgtaccgctgacaaattcgtc
gttcgtctgcccgagggcatgcgtgagcagatcgcagaagtcgctcgcagccatcaccgc
agcatgaactccgagatcatcgcccgactcgagcagagcctgctccaggaaggggcgctg
caagacaatctcggtgttcgcctggacagcccggaactcagcctgcacgagcgcgagctg
ctgcagcgtttccgccagctgacccaccgtcagcagaacgcgctggtcgccctgatcgca
cacgatgcggagctggcccaggcctga

DBGET integrated database retrieval system