KEGG   Pseudomonas aeruginosa PAO1: PA3446
Entry
PA3446            CDS       T00035                                 

Definition
(RefSeq) NAD(P)H-dependent FMN reductase
  KO
K00299  FMN reductase [EC:1.5.1.38]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00740  Riboflavin metabolism
pae00920  Sulfur metabolism
pae01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pae00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    PA3446
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    PA3446
Enzymes [BR:pae01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.38  FMN reductase (NADPH)
     PA3446
SSDB
Motif
Pfam: FMN_red Flavodoxin_2
Other DBs
NCBI-GeneID: 879615
NCBI-ProteinID: NP_252136
UniProt: Q9HYG0
Position
complement(3851920..3852513)
AA seq 197 aa
MLVVSIAGSPSVRSRSGVLLERARDWLSRRGVEVASHQVLDFPAEDLLRARLDSPPVLAL
AEQIGRADGLLVATPVYKASFSGALKVLLDLLPERALEHKVVLPFATGGSSAHMLAVDYA
LKPVLAALKAQEVLHGVFAVDKQIAYATESDPARLEPVLEQRLENALETFHLALSRRPQP
IDPQLLNERLVNARWSI
NT seq 594 nt   +upstreamnt  +downstreamnt
atgctcgtcgtttccatcgccggaagtcccagcgtacgctcccgctccggggtgttgctg
gagcgtgccagggactggctgagccgtcgcggcgtcgaggtggccagccaccaggtgctg
gattttcccgccgaggacctgctgcgtgcccgcctcgacagtccgccggtactggcgctg
gccgagcagatcggccgcgccgacggcctgctggtcgccaccccggtgtacaaggcctcg
ttttccggcgcgctgaaggtcctgctcgacctgttgcccgagcgcgccctggagcacaag
gtggtgctgccgttcgctaccggtggcagcagcgcgcacatgctggccgtggactatgca
ttgaagccggtcctggccgcgctcaaggcccaggaggtactgcatggcgtattcgccgtg
gacaagcagatcgcctacgccaccgagagcgacccggcgcgcctggaaccggtcctcgag
cagcgcctggaaaacgccctggaaaccttccacctggccctctcgcgacggccgcagccg
atcgacccgcagttgctcaacgagcgcctggtgaacgcccgctggagcatctga

DBGET integrated database retrieval system