KEGG   Pseudomonas aeruginosa PAO1: PA3473
Entry
PA3473            CDS       T00035                                 
Name
(RefSeq) chloramphenicol-sensitive protein RarD
  KO
K05786  chloramphenicol-sensitive protein RarD
Organism
pae  Pseudomonas aeruginosa PAO1
Brite
KEGG Orthology (KO) [BR:pae00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pae02000]
    PA3473
Transporters [BR:pae02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   PA3473
SSDB
Motif
Pfam: EamA RseC_MucC
Other DBs
NCBI-GeneID: 878939
NCBI-ProteinID: NP_252163
UniProt: O68827
Position
complement(3886328..3887227)
AA seq 299 aa
MRISGQGVLLSLAASVLFVTLPGYVHLLEPLDSLQVVAHRVVWSIPMVFLLVVATRQWPT
LRAAWCRLFAEPWLLACFPLTAAMMLLQWGIFIWAPLAGKTLELSLGYFLLPLAMVLVGR
VFYGERLTPLQAIAVACALAGVLHEFWLTRAFSWVSLVTALGYPPYFMLRRRMGVDALSG
FVFEMLFLLPLALAALYWLGDESQAFREAPRLWLLLPMLGLISALAFGAMMASSRLLPMG
LFGILSYVEPVLLFLVAVLFLGEAFRPEQLWTYAPIWLAVLLTGWDSARLLRKQARRGI
NT seq 900 nt   +upstreamnt  +downstreamnt
atgaggatttccggacagggcgtgctgctgtcgctggccgcctcggtgctgttcgttacc
ctgccgggctacgtccacctgctggagccgctggacagcctgcaggtggtggcgcatcgg
gtggtctggtcgatcccgatggtattcctgctggtcgtcgccacccgccagtggccgacc
ctgcgcgccgcctggtgccggctgttcgccgagccctggctgctggcctgcttcccgctg
accgcggcgatgatgctgctgcaatggggcatcttcatctgggcgccgttggccgggaaa
acccttgaactgtcgctgggctacttcctcctgccgctggcgatggtgctggtggggcgg
gtgttctacggcgagcgcctgacgccgctgcaggctatcgccgtggcctgcgcgctggcc
ggggtgctccacgagttctggctgacccgcgcgttctcctgggtctccctggtcaccgcg
ctgggctatcccccgtacttcatgctgcggcgcaggatgggcgtggacgcgctgtccggg
ttcgtcttcgagatgctcttcctgctgccgctggcgttggccgcgctgtactggctgggc
gacgagagccaggccttccgcgaggcgccgcgcctgtggctgctgctgccgatgctgggg
ctgatcagcgcgctggccttcggcgcgatgatggcttccagccggctgctgccgatgggg
ctgttcgggattctcagctacgtcgaaccggtgctgctgttcctggtggcggtactgttc
ctcggcgaggcgttccgtcccgagcagctatggacctacgcgccgatctggctggcggtg
ctgttgaccggctgggacagcgcgcgcctgctgaggaaacaggcgcggcggggcatctga

DBGET integrated database retrieval system