KEGG   Pseudomonas aeruginosa PAO1: PA3477
Entry
PA3477            CDS       T00035                                 

Symbol
rhlR
Name
(RefSeq) transcriptional regulator RhlR
  KO
K18099  LuxR family transcriptional regulator, quorum-sensing system regulator RhlR
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae02024  Quorum sensing
pae02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:pae00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PA3477 (rhlR)
   02025 Biofilm formation - Pseudomonas aeruginosa
    PA3477 (rhlR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pae03000]
    PA3477 (rhlR)
Transcription factors [BR:pae03000]
 Prokaryotic type
  Helix-turn-helix
   LuxR family
    PA3477 (rhlR)
SSDB
Motif
Pfam: Autoind_bind GerE Sigma70_r4_2 Sigma70_r4 HTH_20 HTH_23 HTH_38
Other DBs
NCBI-GeneID: 878968
NCBI-ProteinID: NP_252167
UniProt: P54292
Position
complement(3889925..3890650)
AA seq 241 aa
MRNDGGFLLWWDGLRSEMQPIHDSQGVFAVLEKEVRRLGFDYYAYGVRHTIPFTRPKTEV
HGTYPKAWLERYQMQNYGAVDPAILNGLRSSEMVVWSDSLFDQSRMLWNEARDWGLCVGA
TLPIRAPNNLLSVLSVARDQQNISSFEREEIRLRLRCMIELLTQKLTDLEHPMLMSNPVC
LSHREREILQWTADGKSSGEIAIILSISESTVNFHHKNIQKKFDAPNKTLAAAYAAALGL
I
NT seq 726 nt   +upstreamnt  +downstreamnt
atgaggaatgacggaggctttttgctgtggtgggacggtttgcgtagcgagatgcagccg
atccacgacagccagggcgtgttcgccgtcctggaaaaggaagtgcggcgcctgggcttc
gattactacgcctatggcgtgcgccacacgattcccttcacccggccgaagaccgaggtc
catggcacctatcccaaggcctggctggagcgataccagatgcagaactacggggccgtg
gatccggcgatcctcaacggcctgcgctcctcggaaatggtggtctggagcgacagcctg
ttcgaccagagccggatgctctggaacgaggctcgcgattggggcctctgtgtcggcgcg
accttgccgatccgcgcgccgaacaatttgctcagcgtgctttccgtggcgcgcgaccag
cagaacatctccagcttcgagcgcgaggaaatccgcctgcggctgcgttgcatgatcgag
ttgctgacccagaagctgaccgacctggagcatccgatgctgatgtccaacccggtctgc
ctgagccatcgcgaacgcgagatcctgcaatggaccgccgacggcaagagttccggggaa
atcgccatcatcctgagcatctccgagagcacggtgaacttccaccacaagaacatccag
aagaagttcgacgcgccgaacaagacgctggctgccgcctacgccgcggcgctgggtctc
atctga

DBGET integrated database retrieval system