KEGG   Pseudomonas aeruginosa PAO1: PA3487
Entry
PA3487            CDS       T00035                                 

Gene name
pldA
Definition
(RefSeq) phospholipase D
Organism
pae  Pseudomonas aeruginosa PAO1
SSDB
Motif
Pfam: PLDc PLDc_2 FokI_C
Other DBs
NCBI-GeneID: 880040
NCBI-ProteinID: NP_252177
UniProt: Q9HYC2
Position
3902663..3905962
AA seq 1099 aa
MLQKKPYNGLHEKELNQINQQDGSPCVAISAPGCFIKGSNLFSEKRAGNRVRFFTTGRDY
FSDLASALDSASSSIFITGWQVNYDVLLDGRRSLWQCLRQALERSPALKVYVMPWLSPSG
SLGTYDFETMLAVFQLNAGLEGGARAFCTPAIQQSDMQGLGVAFSHHQKSVVIDNRIGYV
GGIDLAYGRRDDNDFSLDASGRRGNDAYNPGLPHLGWMAEDEHVSSMGLMMATLFDLSRP
LASLTLHAPTLRLSPFPHIAASDEPLLSIPLAPSRARALNGAAYLSDLFRSPMLPSLQWL
GRAYNSSKEGLDEGFERLDALRRQMVASSIRAIANLIADNLDALPIEPELERRLRAWLEE
LRTAALNLPEALRIKSLLLINQWMSETELGQVLTLISGKGFEDIPQNLSGKAGELAGSLF
WTLHRLMQARAGGHQQPYRYLDEAPQPLASPDNARLAADQPRMPWQDVHCRIEGPSVYDL
ARNFIDRWNGQQAYLAKTPALQDTALVRSALEAVMKWLNSLAAAAGLENYLDEKRNLRLE
LDPPTPCWINAPEQLPQEPEVRRGGMTVQVLRSAAARMLEQEQAGRLGAGVNLPLQVGVS
TEGVQSNCKDAMLLAISGAQQFIYIENQFFQSEFGKEGEVFKDLPLSGPMASLRDVGSLR
RDFVVRIRLEEALEQRDLWLLDWAEVEKIAQEPGTEARQFLKSMLAMWGVNAQGWLTHKL
GEAQHGLLNEIGEALARRIERAIQREHPFHVYLVLPVHPEGALNVPNIMHQVHLTQQSLV
FGEQSLVKRIQRQMALKALEGKSDPAQAREIIERKDARGRPVYEQQDWSRYLTLLNLRTW
AVLGGRVVTEQIYVHSKLLIADDRVAILGSANINDRSLQGERDSELAVMVRDSEPLTVRL
DGKNDAIVGKAIHQLRVNLWKKHFGLSQGPGGFVKPASELSAYLSIPAAQEAWEAIQTLA
KENTRAYERTFNFIPQNISQTQLQLTPEPPKGFEDGFPASIWPTWAYRKPGELRAGGQLM
EPMPYQEIFWRSSNLTSVKTFPPPNGVSGFITALPTSWTRGERNDSGLNLSILAHQDSRS
LPTQVAMNGDSSAQGKHRT
NT seq 3300 nt   +upstreamnt  +downstreamnt
atgttgcagaagaagccctacaacggcctccacgaaaaggaactcaaccagatcaaccag
caggatggcagcccctgcgtagccatttccgcaccgggctgtttcatcaaggggtccaac
ctcttttccgaaaagcgggccggtaaccgggtccgcttcttcaccaccggccgggactac
ttcagcgacctggccagcgccctcgacagcgccagttcgagcatcttcatcaccggctgg
caggtcaactacgacgtcctcctcgacggccgccgcagcctctggcagtgcctgcgccag
gcgctggagcgctcgcccgcgctgaaggtctacgtgatgccctggctcagcccttccggc
agcctcggcacctatgacttcgaaaccatgctcgcggtgttccagctcaacgccggactc
gagggcggcgcgcgcgccttctgtacgccggcgatccagcagagcgacatgcagggactg
ggcgtcgccttctcccaccaccagaaatccgtggtgatcgacaaccgcatcggctatgtc
ggcgggatcgaccttgcctatggccgtcgcgacgacaacgatttcagcctcgacgcctcc
gggcgccggggcaacgacgcctataatcccggcctaccgcatcttggctggatggcggag
gacgaacacgtcagctccatgggcctgatgatggccaccctgttcgacctttccaggccg
ctcgccagcctgacgctgcatgcgcccacccttcgcctgtcgcccttcccgcacatcgcc
gccagcgacgaaccgctgctgagcattcccctcgcacccagccgcgcccgcgccctcaac
ggcgccgcctacctttccgacctgttccgcagcccgatgctgccctccctgcaatggctc
ggccgcgcctacaacagctcgaaagaaggcctggacgaaggcttcgaacggctcgatgcg
ctcaggcggcagatggtcgccagcagcatccgcgccattgccaacctgatcgccgacaac
ctcgacgccctgcccatcgagcctgaactcgaacgccgcctgcgcgcctggctggaggaa
ctgcgcacggccgcgctcaacctgccggaagccctgcggatcaagagcctgctcctgatc
aaccagtggatgagcgaaaccgaactgggccaggtcctgaccctgatcagcggcaagggc
ttcgaagatatcccgcagaacctgagcggcaaggccggcgagttggccggctcgctgttc
tggacactccacaggctgatgcaggctcgcgccggaggccaccagcaaccctatcgctac
ctggacgaagcgcctcagccattggcctcgccggacaacgcccggctggccgccgaccag
ccgcgcatgccctggcaggatgtgcattgccgcatcgaagggccgtcggtgtacgacctg
gcgcgcaacttcatcgaccgctggaacggccagcaggcctacctggccaagacgccggcg
ctacaggatacggcgctggtacgcagcgccctggaagccgtgatgaagtggctgaacagc
ctggccgccgccgcgggattggagaactacctggacgagaagcgcaacctccggctcgaa
ctggacccacccacgccctgctggatcaacgcgccggaacagttgccgcaagagccggag
gtgcgccgcggcggcatgaccgtacaggtactgcgcagcgccgcggcgcgcatgctcgaa
caggagcaggccggccgcctcggcgcgggagtgaacctgcccttgcaggtcggcgtctcc
accgaaggagtccagagcaactgcaaggacgccatgctcctggcgatttccggggcgcag
cagttcatctatatcgagaaccagttcttccagagcgagttcggcaaggaaggcgaagtt
ttcaaggatctgcccctttcaggccccatggccagtctgcgcgacgttggcagcctgcga
cgcgacttcgtcgtccggatacgcttggaggaagccctggagcagcgcgacctctggctg
ctggactgggccgaagtggagaagatcgcccaggagcctggcaccgaggcccgccagttc
ctcaagtcgatgctcgccatgtggggcgtgaacgcccagggctggctcacccacaagctc
ggcgaagcccagcacggcctgctcaacgagatcggcgaagccctggcgcggcgcatcgaa
cgggccatccagcgcgagcacccgttccacgtctacctggtcctgccggtgcacccggag
ggcgcgctgaacgtgccgaacatcatgcaccaggtgcacctgacccagcagagcctggtg
ttcggcgaacagagcctggtcaagcgcattcagcggcagatggcgctcaaggccctggaa
ggcaagtccgacccggcccaggcccgggaaatcatcgagcgcaaggacgctcgcggtcgc
ccggtctacgaacagcaggactggagccgctacctgaccctgctcaacctgcgcacctgg
gcggtgctcggcgggcgggtggtcaccgaacagatctacgtgcacagcaagctgctgatc
gccgacgaccgggtggccatcctcggcagcgccaatatcaacgaccgcagcctgcaaggc
gagcgcgactccgagctggcggtgatggtgcgcgacagcgagccgctgacggtcaggctg
gacggcaagaacgacgccatcgtcggcaaggccatccaccagttgcgggtgaatttgtgg
aagaagcattttggcttgagccaggggccaggcggtttcgtcaagccggccagcgagttg
agtgcttatctgtccatcccggcggctcaagaggcctgggaagctatacaaacattagcc
aaggagaatactcgtgcctatgaacggactttcaattttattccccaaaatatcagccag
actcaactgcaactgactccagagccgcctaaaggatttgaggacggatttcccgcctcc
atatggcccacctgggcatacagaaaacctggcgagttaagggcgggcggacaactgatg
gagccgatgccatatcaggaaatcttctggcgctcatctaatctcacttcggtgaaaacc
ttcccaccacccaacggggtttccggtttcatcacggctctaccaaccagttggacccgt
ggtgagcgcaatgattctggcttgaatctaagcatcctggcacatcaggacagcagatcg
cttcccacccaggtcgccatgaatggagatagctcggcacaaggaaagcatcgcacatga

DBGET integrated database retrieval system