KEGG   Pseudomonas aeruginosa PAO1: PA3544
Entry
PA3544            CDS       T00035                                 

Symbol
algE
Name
(RefSeq) alginate production protein AlgE
  KO
K16081  alginate production protein
Organism
pae  Pseudomonas aeruginosa PAO1
Brite
KEGG Orthology (KO) [BR:pae00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pae02000]
    PA3544 (algE)
Transporters [BR:pae02000]
 Other transporters
  Pores ion channels [TC:1]
   PA3544 (algE)
SSDB
Motif
Pfam: Alginate_exp OMP_b-brl
Other DBs
NCBI-GeneID: 879838
NCBI-ProteinID: NP_252234
UniProt: P18895
Structure
PDB: 

Position
3968449..3969921
AA seq 490 aa
MNSSRSVNPRPSFAPRALSLAIALLLGAPAFAANSGEAPKNFGLDVKITGESENDRDLGT
APGGTLNDIGIDLRPWAFGQWGDWSAYFMGQAVAATDTIETDTLQSDTDDGNNSRNDGRE
PDKSYLAAREFWVDYAGLTAYPGEHLRFGRQRLREDSGQWQDTNIEALNWSFETTLLNAH
AGVAQRFSEYRTDLDELAPEDKDRTHVFGDISTQWAPHHRIGVRIHHADDSGHLRRPGEE
VDNLDKTYTGQLTWLGIEATGDAYNYRSSMPLNYWASATWLTGDRDNLTTTTVDDRRIAT
GKQSGDVNAFGVDLGLRWNIDEQWKAGVGYARGSGGGKDGEEQFQQTGLESNRSNFTGTR
SRVHRFGEAFRGELSNLQAATLFGSWQLREDYDASLVYHKFWRVDDDSDIGTSGINAALQ
PGEKDIGQELDLVVTKYFKQGLLPASMSQYVDEPSALIRFRGGLFKPGDAYGPGTDSTMH
RAFVDFIWRF
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgaacagctcccgttccgtcaacccgcggccgtccttcgcgccgcgcgccctgtccctg
gccatcgccctgctgctcggcgcgccggcgttcgccgccaacagcggcgaggcgccgaag
aacttcggcctggacgtgaagatcaccggcgaatcggaaaacgatcgcgacctcggcacc
gctcccggcggcaccctcaacgacatcggtatcgacctgcggccctgggccttcggccag
tggggcgactggagcgcctacttcatgggccaggcggtggccgccaccgacaccatcgag
accgacaccctgcaatcggacaccgacgacggcaacaacagccgcaacgacggtcgcgag
ccggacaagagctacctcgccgcacgcgaattctgggtcgactacgccggcctcaccgcc
taccccggcgagcacctgcgcttcggccgccagcgcctgcgggaagacagcggccagtgg
caggacaccaacatcgaggcgctgaactggagcttcgagaccaccctgctcaacgcccac
gccggggtcgcccagcgtttcagcgaataccgcaccgacctcgacgaactggctccggag
gacaaggaccgcacccatgtgttcggcgacatttccacccagtgggcgccgcaccaccgc
ataggcgtgcgcatccaccacgccgacgacagcggccacctgcgccgccccggcgaggaa
gtcgacaacctcgacaagacctataccggccagctcacctggctcggcatcgaggctacc
ggcgatgcctacaactatcgttcgagcatgccgctgaactactgggccagcgccacctgg
ctgaccggcgaccgcgacaacctgaccaccaccacggtcgacgaccggcgcatcgccacc
ggcaagcagagcggcgacgtcaatgccttcggcgtcgacctcggcctgcgctggaacatc
gacgagcaatggaaggccggcgtcggctacgcccgcggcagcggcggtggcaaggacggc
gaggagcagttccagcagaccgggctggagagcaatcgctccaacttcaccggcacccgc
tcgcgcgtgcaccgcttcggcgaagccttccgcggcgaactgagcaacctccaggcagcc
accctgttcggctcctggcaactgcgcgaggactacgacgcgagcctggtctaccacaag
ttctggcgcgtcgacgacgactccgacatcggtaccagcggcatcaacgccgccctgcaa
ccgggcgagaaggacatcggccaggaactcgacctggtggtgaccaagtacttcaagcaa
ggcctgctgccggcctcgatgagccagtacgtcgacgagccctcggcgctgatccgcttc
cgcggcggcctgttcaagccgggcgacgcctacgggccgggcaccgactcgaccatgcac
cgcgccttcgtcgacttcatctggcgcttctga

DBGET integrated database retrieval system