KEGG   Pseudomonas aeruginosa PAO1: PA3746Help
Entry
PA3746            CDS       T00035                                 

Gene name
ffh
Definition
(RefSeq) signal recognition particle protein Ffh
  KO
K03106  signal recognition particle subunit SRP54 [EC:3.6.5.4]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae02024  Quorum sensing
pae03060  Protein export
pae03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pae00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    PA3746 (ffh)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PA3746 (ffh)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PA3746 (ffh)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pae02044]
    PA3746 (ffh)
Enzymes [BR:pae01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.4  signal-recognition-particle GTPase
     PA3746 (ffh)
Secretion system [BR:pae02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   PA3746 (ffh)
  Eukaryotic Sec-SRP protein
   PA3746 (ffh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SRP54 SRP_SPB SRP54_N CbiA Zeta_toxin AAA_22 cobW APS_kinase AAA_33 AAA_30 AAA_31 AAA_24 KTI12 DUF2075 Thymidylate_kin ABC_tran ParA T2SSE 6PF2K DnaB_C Mg_chelatase AAA_16 MMR_HSR1 AAA_5 AAA_17 AAA_18 DUF3142 AAA_28 ArsA_ATPase
Motif
Other DBs
NCBI-GeneID: 880310
NCBI-ProteinID: NP_252435
UniProt: Q9HXP8
Position
complement(4197169..4198542)
Genome map
AA seq 457 aa AA seqDB search
MFENLTDRLSQTLRHVTGKAKLTEDNIKDTLREVRMALLEADVALPVVKDFVNKVKERAV
GTEVSKSLTPGQAFVKIVRAELEELMGAANEDLALSVAPPAVILMAGLQGAGKTTTAGKL
ARFLKERKKKSVMVVSADVYRPAAIKQLETLAGEVGVTFFPSDVSQKPVAIAEAAIREAR
LKFIDVVIVDTAGRLHIDADMMDEIKQVHAAIKPAETLFVVDAMTGQDAANTAKAFNDAL
PLTGVVLTKVDGDARGGAALSVRAITGKPIKFLGMGEKSEALDPFHPDRVASRILGMGDV
LSLIEQAEQNLDRDKAEKLAKKIKKGKGFDLEDFRDQLQQMKNMGGLGGLMDKLPMLGGV
NLAQMGNAQGAAEKQFKQMEAIINSMTPGERRDPEMISGSRKRRIALGSGTQVQDVGRLI
KQHKQMQKMMKKVTAKGGMAKMMRGMGSMFPGGMPKL
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaaaaccttacagaccgcctctcgcagacgcttcgccatgtcaccggcaaggcc
aagctgaccgaggacaacatcaaggacactctgcgcgaagtgcgcatggccctgctcgag
gccgacgtggccctgccggtggtcaaggacttcgtcaacaaggtcaaggagcgcgccgtc
ggtaccgaggtctcgaagagcctgaccccgggacaggcgttcgtgaagatcgtccgcgcc
gagctcgaggagctgatgggggcggccaacgaggacctggcgctgagcgtcgcgccgccg
gcggtgatcctgatggccggcctgcagggcgcgggcaagaccaccaccgcgggcaagctg
gcgcgcttccttaaggaacgcaagaagaagtcggtgatggtggtttccgccgacgtctac
cgacccgccgctatcaagcagctggaaaccctggcgggcgaggtcggcgtaaccttcttc
ccttccgacgtcagccagaagccggtggccatcgccgaggcggcgatccgcgaggcgagg
ctgaagttcatcgacgtggtgatcgtcgataccgcaggccgcctgcacatcgatgccgac
atgatggacgagatcaagcaggtgcacgcggcgatcaagccggcggaaaccctgttcgtg
gtcgatgccatgaccggccaggatgccgccaacaccgccaaggccttcaatgacgccttg
ccgctgaccggcgtggtcctgaccaaggtcgacggcgacgcgcgtggtggtgccgcgctc
tcggtgcgggcgatcaccggcaagccgatcaagttcctcggcatgggcgaaaagagcgaa
gcgctcgatccgttccatcccgaccgcgtggcctcgcgcatcctcggcatgggcgacgtg
ctcagcctgatcgaacaggccgagcagaacctcgaccgcgacaaggccgagaagctggcg
aagaagatcaagaagggcaagggcttcgacctggaagacttccgcgaccagttgcaacag
atgaagaacatgggcggcctcggcgggctcatggacaagctgccgatgctcggcggggtc
aacctggcgcagatgggcaatgcccagggtgctgcggagaaacagttcaagcagatggag
gcgatcatcaactcgatgacgcccggcgaacggcgcgatccggaaatgatcagcggctcg
cgcaagcgccgcatcgcccttggctccggtacccaggtgcaggacgtcggccggctgatc
aagcagcacaagcagatgcagaagatgatgaagaaggtcaccgccaagggcggcatggcc
aagatgatgcgaggcatgggcagtatgttcccggggggcatgcccaagctttga

DBGET integrated database retrieval system