KEGG   Pseudomonas aeruginosa PAO1: PA3807Help
Entry
PA3807            CDS       T00035                                 

Gene name
ndk
Definition
(RefSeq) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00230  Purine metabolism
pae00240  Pyrimidine metabolism
pae01100  Metabolic pathways
pae01110  Biosynthesis of secondary metabolites
pae01130  Biosynthesis of antibiotics
Module
pae_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
pae_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
pae_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
pae_M00053  Pyrimidine deoxyribonuleotide biosynthesis, CDP/CTP => dCDP/dCTP,dTDP/dTTP
Brite
KEGG Orthology (KO) [BR:pae00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    PA3807 (ndk)
   00240 Pyrimidine metabolism
    PA3807 (ndk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pae04131]
    PA3807 (ndk)
Enzymes [BR:pae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     PA3807 (ndk)
Membrane trafficking [BR:pae04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    PA3807 (ndk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-GeneID: 879892
NCBI-ProteinID: NP_252496
UniProt: Q59636
Structure
PDB: 

Position
complement(4266470..4266901)
Genome map
AA seq 143 aa AA seqDB search
MALQRTLSIIKPDAVSKNVIGEILTRFEKAGLRVVAAKMVQLSEREAGGFYAEHKERPFF
KDLVSFMTSGPVVVQVLEGEDAIAKNRELMGATDPKKADAGTIRADFAVSIDENAVHGSD
SEASAAREIAYFFAATEVCERIR
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggcactgcaacgcaccctgtccatcatcaagccggacgccgtttccaagaacgtgatc
ggcgaaatcctgacccgcttcgagaaagccggcctgcgcgtcgtcgccgctaaaatggtt
cagctgtccgagcgtgaagccggtggcttctatgccgagcacaaagagcgtccgttcttc
aaggacctggtttccttcatgacttccggtccggttgtagtccaggttctggaaggcgag
gacgccatcgccaagaaccgcgagctgatgggcgccaccgatccgaagaaagccgacgcc
ggtaccatccgcgccgacttcgccgtctccatcgacgagaacgccgtccacggttccgat
tccgaagcttccgccgctcgcgagatcgcctacttcttcgcggctaccgaagtctgcgag
cgcattcgctga

DBGET integrated database retrieval system