KEGG   Pseudomonas aeruginosa PAO1: PA3820
Entry
PA3820            CDS       T00035                                 

Gene name
secF
Definition
(RefSeq) preprotein translocase subunit SecF
  KO
K03074  preprotein translocase subunit SecF
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae03060  Protein export
pae03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pae00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    PA3820 (secF)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PA3820 (secF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pae02044]
    PA3820 (secF)
Secretion system [BR:pae02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   PA3820 (secF)
SSDB
Motif
Pfam: SecD_SecF Sec_GG
Other DBs
NCBI-GeneID: 879904
NCBI-ProteinID: NP_252509
UniProt: Q9HXI2
Position
complement(4276154..4277074)
AA seq 306 aa
MNIKIGTINFMGIRNVAFAVTLILTVIALGSWFTKGINFGLDFTGGTLIELTYEQPADLG
KVRGQLVGAGYEDAVVQSFGDARDVLVRMPSEDPELGKKVATALQQADAGNPANLKRVEY
VGPQVGEELRDQGGLGMLLALGGILLYVGFRFQWKFALGAILSLVHDAIIVMGVLSFFQV
TFDLTVLAAVLAVVGYSLNDTIVIFDRVRENFRVLRKADLVENLNISTSQTLLRTIATSV
STLLAIAALLFFGGDNLFGFSIALFVGVMAGTYSSIYIANVVLIWLNLTSEDLIPPQAKD
TVDDRP
NT seq 921 nt   +upstreamnt  +downstreamnt
atgaatatcaagatcggtaccatcaacttcatgggcatccgcaacgtcgcgtttgccgtc
accctgatcctgaccgtcatcgccctgggcagctggttcaccaagggcatcaacttcggc
ctcgacttcaccggcggtacgctgatcgagctgacctacgaacaaccggccgatctcggc
aaggtgcgtggtcaactggtcggcgccggctatgaggacgccgtggtgcagagcttcggc
gacgcccgcgacgtgctggtgcggatgcccagcgaggacccggaactgggcaagaaggtc
gctaccgccttgcagcaggccgatgccggcaacccggcgaacctgaagcgggtcgagtac
gtcggcccgcaggtgggtgaagaactgcgcgaccagggcggcctcggcatgctcctggcg
ctgggcggcatcctgctgtacgtcggcttccgcttccagtggaagttcgccctcggtgcg
atcctctcgctggtgcacgatgcgatcatcgtgatgggcgtgctgtcgttcttccaggtg
accttcgacctgaccgtcctcgccgctgtgctggcggtggtcggttactcgctgaacgac
accatcgtgatcttcgaccgggtgcgcgagaacttccgcgtgctgcgcaaggccgatctg
gtcgagaacctgaacatctccaccagccagaccctgttgcgtaccatcgccacctcggtt
tccacgctgctggctatcgccgcgctgctgttcttcggcggcgacaatctgttcggtttc
tccatcgccctgttcgtcggtgtaatggcgggtacctactcgtcgatctacatcgccaac
gtggtattgatctggctgaacctgaccagcgaggacctgatcccgccgcaggccaaggac
accgtcgacgatcgcccctga

DBGET integrated database retrieval system