KEGG   Pseudomonas aeruginosa PAO1: PA3896Help
Entry
PA3896            CDS       T00035                                 

Definition
(RefSeq) 2-hydroxyacid dehydrogenase
  KO
K00090  glyoxylate/hydroxypyruvate/2-ketogluconate reductase [EC:1.1.1.79 1.1.1.81 1.1.1.215]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00030  Pentose phosphate pathway
pae00260  Glycine, serine and threonine metabolism
pae00620  Pyruvate metabolism
pae00630  Glyoxylate and dicarboxylate metabolism
pae01100  Metabolic pathways
pae01110  Biosynthesis of secondary metabolites
pae01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PA3896
   00620 Pyruvate metabolism
    PA3896
   00630 Glyoxylate and dicarboxylate metabolism
    PA3896
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PA3896
Enzymes [BR:pae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     PA3896
    1.1.1.81  hydroxypyruvate reductase
     PA3896
    1.1.1.215  gluconate 2-dehydrogenase
     PA3896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 F420_oxidored
Motif
Other DBs
NCBI-GeneID: 879660
NCBI-ProteinID: NP_252585
UniProt: Q9HXB7
Position
4364278..4365255
Genome map
AA seq 325 aa AA seqDB search
MKKNVFVFSRLAPEHLERLQCQFNVRVLEPKQGDIDAQYAAALPDTHGMIGVGRPLGARQ
LEQAKQLEVISSVSVGYDNYDLDYLNRRGIALTNTPDVLTETTADLGFALLISAARRVAE
LDAWVKAGNWKRTVDAPQFGTDVHGKKLGILGLGRIGAAIARRGRFGFGMQVLYHGNNRK
PELEQELGARFLGFDELLGEADFVCVVVPLGAQTRQLIGARELGLMKPSAILVNVARGQV
VDEAALVAALREKRILGAGLDVYEKEPLAESPLFALDNVVTLPHIGSATHETRRAMAERA
LQNFEAALRGERPLDLVNPQVWRRG
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaacgtcttcgtcttcagtcgcctcgcccccgagcatctcgaacgcctgcaa
tgccagttcaacgtccgcgtgctcgaaccgaaacagggcgacatcgacgcccagtacgcc
gccgccctgcccgatacccacggcatgatcggcgtcggccggccgctcggcgccaggcaa
ctggaacaggcgaagcagctggaagtcatctccagcgtctcggtcggctacgacaactat
gacctggactacctgaaccgccgcggcatcgctctcaccaacacgcccgacgtcctcacc
gagaccaccgccgacctcggcttcgccctgctgatcagcgccgcgcgacgggtcgccgag
ctggacgcctgggtcaaggccggaaactggaagcgcaccgtcgacgccccgcagttcggc
accgacgtgcatggcaagaaactcggcatcctcggcctcggccggatcggcgcggccatc
gcccggcgcggccgtttcggcttcggcatgcaggtgctctaccacggcaacaaccgcaag
ccggaactggaacaggaactcggcgcgcgcttcctcggcttcgacgaactgctcggcgag
gccgacttcgtctgcgtggtggtgccgctgggagcgcagacccggcagttgatcggtgca
cgcgaactgggcctgatgaaaccctcggcgatcctggtcaacgtcgcccgcggccaggtg
gtcgatgaggccgcgctggtcgccgccctgcgggagaagcgcatcctcggcgccggcctg
gatgtctacgagaaggaaccgctggccgaatcgccgctgttcgccctggacaacgtggtg
accctgccgcacatcggctcggccacccacgagacccgccgggccatggccgagcgggcg
ctgcagaacttcgaggcggccctgcgcggcgagcggccgctggacctggtcaatccacag
gtgtggcgacgcggctga

DBGET integrated database retrieval system