KEGG   Pseudomonas aeruginosa PAO1: PA3904
Entry
PA3904            CDS       T00035                                 

Name
(RefSeq) hypothetical protein
Organism
pae  Pseudomonas aeruginosa PAO1
SSDB
Motif
Pfam: PAAR_motif Abhydrolase_6
Other DBs
NCBI-GeneID: 878950
NCBI-ProteinID: NP_252593
UniProt: Q9HXA9
Position
4373938..4374333
AA seq 131 aa
MSGKPAARLGDPTACPLPGHGSNPIVGGSPDVFFDHLSAARQGDATACGATLSANVIANV
LINGKPATVVGSVGTHGNLVVGGAGTVLIGNSGGGAPALALAPPKLCLQCLLLAARRNQA
LVPLESLGGAP
NT seq 396 nt   +upstreamnt  +downstreamnt
atgagcggcaaacccgctgcgcgcctgggcgatccgaccgcgtgtccgctgccgggccac
ggcagcaacccgatcgtcggcggctcgcccgacgtcttcttcgaccatctgtccgctgcc
cgccagggcgacgccaccgcctgcggcgccaccctcagcgccaacgtcatcgccaacgta
ctgatcaacggcaagcccgccaccgtggtaggtagcgtcggcacccacggcaacctggtg
gtcggcggggcgggcacggtgctgatcggcaacagcggcggcggcgcacccgctctcgcc
ctcgccccaccgaagctgtgcctgcaatgcctgctgctggcggcacgccgcaaccaggcc
ctggtgcccctggaaagcctcggcggcgcaccgtga

DBGET integrated database retrieval system