KEGG   Pseudomonas aeruginosa PAO1: PA3905
Entry
PA3905            CDS       T00035                                 

Name
(RefSeq) hypothetical protein
Organism
pae  Pseudomonas aeruginosa PAO1
SSDB
Motif
Pfam: DUF4123
Other DBs
NCBI-GeneID: 878951
NCBI-ProteinID: NP_252594
UniProt: Q9HXA8
Position
4374330..4374857
AA seq 175 aa
MSRLQPALAAPTPDSRLFALADGARYLTLDTRLEKAAGEIRSRWLLAGSELDEIAHAGPV
LIEFMDSAPLSSSGEFLGWLRDWDRRSPMASWLWSRASFENLAKHFAGLLFTRMPDGRRA
LLRYYSPEVRRALEQVMTARQWTQVMAPLERWQVWQPLQGGYLVYDRETERTADA
NT seq 528 nt   +upstreamnt  +downstreamnt
gtgagccggctccagccggcgctcgcggcgcctacgccggacagccgcctgttcgccctg
gcggacggcgcccgctacctgaccctggacacccgcctggaaaaggccgcgggggaaatc
cgctcgcgctggctgctggccgggagcgagctggacgaaatcgcccatgccgggccggtc
ctgatcgaattcatggacagcgccccgctttcgtcatcgggcgagttcctcggctggctg
cgcgactgggaccgccgctcgcccatggcctcctggctgtggagccgggcgtccttcgaa
aacctcgcgaaacacttcgccgggctgctcttcacccgcatgcccgacggccgccgggcg
ctgttgcgctactacagcccggaagtgcgccgggcgctggaacaggtcatgaccgcgcgg
caatggacgcaagtgatggcgccgctggagcgttggcaggtctggcagcccctgcagggc
ggctacctcgtctatgaccgggaaacggagcggaccgccgatgcttga

DBGET integrated database retrieval system