KEGG   Pseudomonas aeruginosa PAO1: PA3906
Entry
PA3906            CDS       T00035                                 

Name
(RefSeq) hypothetical protein
Organism
pae  Pseudomonas aeruginosa PAO1
SSDB
Other DBs
NCBI-GeneID: 878940
NCBI-ProteinID: NP_252595
UniProt: Q9HXA7
Position
4374850..4375233
AA seq 127 aa
MLELDAGQLDRLQRVRDDEVIERVLLEVRREAPAWLERRGLLPAIRQLGELRATALELGI
EEPGTIERFLLHGLAFPAFQDTPAFLAHMRRPLADSPEQRFQDYERIVEFRLASQKWRAY
ETSGRPA
NT seq 384 nt   +upstreamnt  +downstreamnt
atgcttgaactggatgccggccaactggatcgcctgcagcgggtccgcgacgacgaagtc
atcgagcgggtcctgctggaggtacgccgggaggctcccgcctggctcgaacgacgcggc
ctgctgcccgccatccggcaactcggcgagctgcgcgcgacggcgctggaactgggtatc
gaagagcccgggacgatcgaacgctttcttctgcacggcctggccttccccgctttccag
gacacgccggcgtttctcgcacacatgcgccggccgctggcggacagcccggaacaacgc
ttccaggactacgaacggatcgtcgagtttcgcctggccagccagaaatggcgcgcgtac
gaaacctcggggagaccggcatga

DBGET integrated database retrieval system