KEGG   Pseudomonas aeruginosa PAO1: PA3907
Entry
PA3907            CDS       T00035                                 

Name
(RefSeq) hypothetical protein
Organism
pae  Pseudomonas aeruginosa PAO1
SSDB
Motif
Pfam: Tox-REase-5
Other DBs
NCBI-GeneID: 878941
NCBI-ProteinID: NP_252596
UniProt: Q9HXA6
Position
4375230..4376015
AA seq 261 aa
MSGIGALFRPLPRMGPRLPFELPAPPRPHLPMPAPRPLPRPAPGALPRPVPRPMPVPQTL
PRTETGTLSRDRTREAERDCSKSQGRDKDCVECPPSRGEMAIANNGKGHSMSDLSARYQQ
WVTNFPFPHEWFWSGTWWDGFDEPRCTLLEAKANYAFLFVPLLGVPRPWARAKVKSDLLQ
KAEVHSDKARPTPPVFVEWHFLQRIVYEYCAAEYLRMGLANLKAFWNPMPGTDEHDDYQE
TRAKEQEEMKRFCEENPGYCA
NT seq 786 nt   +upstreamnt  +downstreamnt
atgagcggcataggcgcgcttttccgaccgctgccccgcatgggtccgcggctgcccttc
gaactacccgcgccgccccggccgcacttgccgatgccggcgccgcgcccgctgccgcga
ccggcccccggcgcactgcccaggccggtaccgcgtccgatgccggtgccgcagaccctg
cccaggaccgagaccggcacgctgagccgcgaccggacccgggaagccgagcgcgattgc
agcaagagccagggccgcgacaaggactgcgtggagtgcccgccgtcccggggcgaaatg
gccatcgccaataacggcaagggccacagcatgtcggacctgtccgcgcgctaccagcag
tgggtgaccaatttcccgtttccccacgaatggttctggagcggcacctggtgggacggc
ttcgacgagccgcgctgcaccctgctggaggcgaaggccaactacgccttcctgttcgtc
ccgctgctcggcgtgcccaggccctgggcacgggccaaggtgaagtcggacctgctgcag
aaggccgaggtccacagcgacaaggcccgaccgaccccgccggtgttcgtcgaatggcac
ttcctgcagcggatcgtctacgagtactgcgccgcggagtacctgcgcatgggactggcc
aacctgaaggcattctggaatccgatgccgggaacggacgagcacgacgactaccaggaa
acccgcgcgaaggaacaggaagagatgaaaaggttttgcgaagagaacccggggtattgc
gcatga

DBGET integrated database retrieval system