KEGG   Pseudomonas aeruginosa PAO1: PA3925Help
Entry
PA3925            CDS       T00035                                 

Definition
(RefSeq) acyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00071  Fatty acid degradation
pae00072  Synthesis and degradation of ketone bodies
pae00280  Valine, leucine and isoleucine degradation
pae00310  Lysine degradation
pae00362  Benzoate degradation
pae00380  Tryptophan metabolism
pae00620  Pyruvate metabolism
pae00630  Glyoxylate and dicarboxylate metabolism
pae00640  Propanoate metabolism
pae00650  Butanoate metabolism
pae00900  Terpenoid backbone biosynthesis
pae01100  Metabolic pathways
pae01110  Biosynthesis of secondary metabolites
pae01120  Microbial metabolism in diverse environments
pae01130  Biosynthesis of antibiotics
pae01200  Carbon metabolism
pae01212  Fatty acid metabolism
pae02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pae00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PA3925
   00630 Glyoxylate and dicarboxylate metabolism
    PA3925
   00640 Propanoate metabolism
    PA3925
   00650 Butanoate metabolism
    PA3925
  Lipid metabolism
   00071 Fatty acid degradation
    PA3925
   00072 Synthesis and degradation of ketone bodies
    PA3925
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PA3925
   00310 Lysine degradation
    PA3925
   00380 Tryptophan metabolism
    PA3925
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PA3925
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PA3925
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PA3925
Enzymes [BR:pae01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PA3925
Exosome [BR:pae04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PA3925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 879047
NCBI-ProteinID: NP_252614
PathoGenesis: PA3925
UniProt: P96961 G3XD40
Position
4400123..4401298
Genome map
AA seq 391 aa AA seqDB search
MSDIVIVAGARTPMGGFQGSLAGVSAVDLGAVAIREAVQRAGIAAEDVQEVIMGCVLPAG
LKQGPARQAALAAGLPAATGCTTINKLCGSGMKAVMLAHDLLKAGTNQVMVAGGMESMSN
APYVLEKARSGLRMGHGEIKDHMFLDGLEDARTGRLMGSFAQETADKYGVTREEMDAYAI
ESLKRAQAAIADGSLAAEIVPVTVTSRKGESVVKDDEQPLTANLEKIPSLRPAFRKDGTI
TAANASSISDGASALVLMTAEEAQRRGLKPLARIVGHATQSQDPSEFTLAPIGAMTNLFA
RTGWSKDDVDLFEINEAFAMVTMLAMREHGLDHAKVNVYGGACAQGHPVGSTGSRIILTL
INALRQKGGKRGVASLCIGGGEATAVALELL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatatcgtcatcgtcgccggcgcccgtactcccatgggcggcttccagggcagc
ctggccggcgtttccgcggtcgacctgggtgccgtcgcgatccgcgaagcggtgcagcgc
gccggcatcgccgccgaggacgtacaggaagtgatcatgggttgcgtcctgcccgccggc
ctgaagcagggcccggcccgccaggccgcgctggcggccggcctgcccgccgccaccggc
tgcaccaccatcaacaagctgtgcggctcggggatgaaggcggtgatgctggcccacgac
ctgctcaaggctggcaccaaccaggtgatggtcgccggtggcatggaaagcatgtccaac
gcgccctatgtcctggagaaagcccgcagcggcctgcgcatgggccacggcgagatcaag
gaccacatgttcctcgacggcctggaggacgcccgtaccggccgtttgatgggttcgttc
gcccaggagaccgccgacaagtacggcgtgacccgcgaggagatggacgcctatgccatc
gaatcgctcaagcgcgcccaggccgccatcgccgatggctcgctggcggcggaaatcgtc
ccggtcaccgtcaccagccgcaagggcgagagcgtggtgaaggacgacgagcaaccgctg
accgccaacctggagaagatcccgagcctcaggccggcgttccgcaaggacggtaccatc
accgccgccaatgccagctcgatctccgacggcgcctccgcgctggtcctgatgaccgcc
gaggaagcccagcgccgtggcctgaagccgctggcgcgaatcgtcggccatgccacccag
agccaggacccgagcgagttcaccctggcgccgatcggcgcgatgaccaacctgttcgcc
aggaccggctggagcaaggacgacgtcgacctgttcgagatcaacgaagccttcgccatg
gtcaccatgctcgccatgcgcgaacacggcctcgatcatgccaaggtcaatgtctatggc
ggcgcctgcgcccagggccatccggtcggttccaccggctcgcggatcatcctcaccctg
atcaacgccctgcgccagaaaggcggcaagcgcggcgtcgcctcgctgtgcatcggcggc
ggcgaagccaccgccgtggcgctcgaactgctctga

DBGET integrated database retrieval system