KEGG   Pseudomonas aeruginosa PAO1: PA3977Help
Entry
PA3977            CDS       T00035                                 

Gene name
hemL
Definition
(RefSeq) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00860  Porphyrin and chlorophyll metabolism
pae01100  Metabolic pathways
pae01110  Biosynthesis of secondary metabolites
pae01120  Microbial metabolism in diverse environments
Module
pae_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:pae00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PA3977 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pae01007]
    PA3977 (hemL)
Enzymes [BR:pae01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     PA3977 (hemL)
Amino acid related enzymes [BR:pae01007]
 Aminotransferase (transaminase)
  Class III
   PA3977 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 880859
NCBI-ProteinID: NP_252666
UniProt: P48247
Structure
PDB: 

Position
4457362..4458645
Genome map
AA seq 427 aa AA seqDB search
MSRSETLFNNAQKHIPGGVNSPVRAFKSVGGTPLFFKHAEGAYVLDEDDKRYVDYVGSWG
PMILGHSHPDVLDAVRRQLDHGLSYGAPTALEVEMADLVCSMVPSMEMVRMVSSGTEATM
SAIRLARGYTGRDSIIKFEGCYHGHSDSLLVKAGSGALTFGVPNSPGVPAAFAKHTLTLP
FNDIEAVRKTLGEVGKEVACIIVEPVAGNMNCVPPAPGFLEGLREACDEHGVVLIFDEVM
TGFRVALGGAQAYYGVTPDLSTFGKIIGGGMPVGAFGGKREIMQQISPLGPVYQAGTLSG
NPLAMAAGLTTLRLISRPGFHDELTAYTTRMLDGLQQRADAAGIPFVTTQAGGMFGLYFS
GADAIVTFEDVMASDVERFKRFFHLMLDGGVYLAPSAFEAGFTSIAHGDKELEITLNAAE
KAFAALK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgttccgaaacgctgttcaacaacgcccagaaacacattcccggcggggtcaac
tccccggtgcgcgccttcaagagcgtcggcggcaccccgctgttcttcaagcacgccgaa
ggcgcctatgtactggacgaggacgacaagcgctacgtggactatgtcggctcctggggc
ccgatgatcctcggccacagccatccggacgtgctcgacgcggtgcgccggcaactcgac
cacggcctgtcctatggcgcgccgaccgcgctggaagtggaaatggccgacctggtctgc
tccatggtgccgtcgatggagatggtgcgcatggtcagctccggcaccgaggcgaccatg
agcgccatccgcctggcccgcggctacaccgggcgcgacagcatcatcaagttcgaaggc
tgctaccacggtcactccgacagcctgctggtgaaggccggctccggcgccctgaccttc
ggcgtgccgaactccccgggcgttccggcggccttcgccaagcacaccctgaccctgccg
ttcaacgacatcgaggcggtgcgcaagaccctgggcgaagtcggcaaggaggtcgcctgc
atcatcgtcgagccggttgccggcaacatgaactgtgtgccgccggcgccgggcttcctc
gaaggcctgcgcgaagcctgcgacgaacacggcgtggtgctgatcttcgacgaagtgatg
accggcttccgtgtcgccctcggcggcgcccaggcctactacggggtcaccccggacctg
tcgaccttcggcaagatcatcggcggcggcatgccggtgggcgccttcggcggcaagcgc
gagatcatgcagcagatttccccgctgggcccggtctaccaggccggcacgctctcgggc
aacccgctggcaatggccgccggcctgaccaccctgcgcctgatcagccgccccggtttc
cacgacgaactgaccgcctacaccacgcgcatgctcgacggcctgcaacagcgcgcggat
gccgccggcatccccttcgtcaccacccaggcgggcggcatgttcggcctgtacttcagc
ggcgccgacgccatcgtcaccttcgaggacgtgatggccagcgacgtcgaacgcttcaag
cgcttcttccacctgatgctcgacggtggcgtgtaccttgcgcctagcgccttcgaggcc
ggcttcacctccatcgcccatggcgacaaggagctggaaatcacgctgaacgccgccgaa
aaagccttcgccgcgctgaaatga

DBGET integrated database retrieval system