KEGG   Pseudomonas aeruginosa PAO1: PA4047
Entry
PA4047            CDS       T00035                                 

Gene name
ribA
Definition
(RefSeq) GTP cyclohydrolase II
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00740  Riboflavin metabolism
pae00790  Folate biosynthesis
pae01100  Metabolic pathways
pae01110  Biosynthesis of secondary metabolites
pae01240  Biosynthesis of cofactors
pae02024  Quorum sensing
Module
pae_M00125  Riboflavin biosynthesis, plants and bacteria, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:pae00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    PA4047 (ribA)
   00790 Folate biosynthesis
    PA4047 (ribA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PA4047 (ribA)
Enzymes [BR:pae01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     PA4047 (ribA)
SSDB
Motif
Pfam: GTP_cyclohydro2
Other DBs
NCBI-GeneID: 879059
NCBI-ProteinID: NP_252736
UniProt: Q9HWY1
Position
complement(4529995..4530612)
AA seq 205 aa
MSVVFVAASKLPTPFGEFTMHGFLDEESGKEHVALSMGDIADGAPVLGRLHSECLTGDAL
FSLRCDCGFQLEGALAAIAEEGRGVLLYLRQEGRGIGLLNKIRAYELQDGGADTVEANLQ
LGFGADQRDYAMCQPMLAHLGVSSLRLMTNNPRKVKALESYAITVAERVPLQKGLNKHNR
RYLATKAGKLGHMLGSLHQGEAETT
NT seq 618 nt   +upstreamnt  +downstreamnt
gtgtccgtcgtgttcgtcgccgcctccaaactgccgactcccttcggcgaattcaccatg
catggtttcctcgacgaggagagcggcaaggaacatgtagccctgagcatgggcgacatc
gccgatggcgcgccggtgcttggtcgcctgcattccgaatgcctgaccggcgacgcgctg
ttcagcctgcgctgcgattgcggtttccagctggaaggcgcgcttgccgccatcgccgag
gagggccgcggcgtgctcctctacctgcgccaggaaggtcgcggcatcggcctgctgaac
aagatccgtgcctatgaattgcaggatggcggtgccgacaccgtcgaggcgaacctgcaa
ctgggttttggcgccgaccagcgcgactacgccatgtgccagccgatgctcgcgcacctg
ggcgtctcctccctgcgcctgatgaccaacaatccgcgcaaggtcaaggcgctggaaagc
tacgccatcaccgtggcggagcgcgtgccgctgcaaaagggcctgaacaagcacaacagg
cgctacctggcgaccaaggccggcaagctcgggcacatgctcggcagcctgcaccagggc
gaggcggaaaccacgtga

KEGG   Pseudomonas aeruginosa PAO1: PA4054
Entry
PA4054            CDS       T00035                                 

Gene name
ribB
Definition
(RefSeq) 3,4-dihydroxy-2-butanone-4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00740  Riboflavin metabolism
pae00790  Folate biosynthesis
pae01100  Metabolic pathways
pae01110  Biosynthesis of secondary metabolites
pae01240  Biosynthesis of cofactors
Module
pae_M00125  Riboflavin biosynthesis, plants and bacteria, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:pae00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    PA4054 (ribB)
   00790 Folate biosynthesis
    PA4054 (ribB)
Enzymes [BR:pae01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     PA4054 (ribB)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     PA4054 (ribB)
SSDB
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Other DBs
NCBI-GeneID: 878914
NCBI-ProteinID: NP_252743
UniProt: Q9HWX4
Position
complement(4534710..4535807)
AA seq 365 aa
MALNTIDELIEDIRQGKMVILMDDEDRENEGDLIMAAECVRTEDINFMVKHARGLVCMPM
TRERCERLGLPLMVQRNGSGFGTKFTVSIEAAEGVTTGISAADRARTVQAAAAKNAVAAD
IVSPGHIFPLMAQPGGTLARAGHTEAACDLARMAGFEPSGVICEVMNDDGSMARRPELEA
FAAEHGIKIGTIADLIHYRLIHERTVERIAEQPLDSELGHFNLITYRDSVEGDVHLALTL
GKVCAEEPTLVRVHNMDPLRDLLQVNQPGRWSLRAAMTKVAEAGSGVVLLLGHQIGGDDL
LAHVREIASAPAPAPKATTTYSTVGAGSQILRDLGVRKMRLLSAPMRFNAISGFDLEVVE
YLPAE
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggcactcaacacgatcgacgaactgatcgaagacatccgccaaggcaagatggtcatc
ctgatggatgacgaggaccgcgagaacgaaggcgacctgatcatggccgccgaatgcgtc
cgcaccgaagacatcaacttcatggtcaagcatgcccgcggcctggtctgcatgccgatg
acccgcgagcgttgcgagcgcctcggcctgccgctgatggtgcagcgcaacggctccggc
ttcggcaccaagttcactgtctccatcgaggccgccgagggcgtcaccaccggcatctcc
gccgcggaccgcgcccgcaccgtgcaggctgcggcggcgaagaacgccgtggccgccgac
atcgtcagccccggccacatcttcccgctgatggcccagccgggcggtaccctggctcgc
gccgggcacaccgaggcggcctgcgacctggcgcggatggccgggttcgagccgtccggg
gtgatctgcgaggtgatgaacgacgacggcagcatggctcgccggcccgaactggaggcg
ttcgccgccgagcacgggatcaagatcggcaccatcgccgacctgatccactaccggctg
atccacgagcgcaccgtcgagcgcatcgccgagcagccgctcgacagcgaactgggccac
ttcaacctgatcacctaccgcgactcggtggagggcgacgtgcacctggcgctgaccctc
ggcaaggtctgcgcggaagagccgaccttggtccgcgtgcataacatggacccgctgcgc
gacctgctgcaggtcaaccaaccgggccgctggagcctgcgcgcggcgatgaccaaggtc
gccgaggcgggcagcggcgtggtgctgctgctcggtcaccagatcggcggcgacgacctg
ctcgcccatgtccgcgagatcgcttcggcgccggctccggcgcccaaggccaccaccacc
tacagcaccgtcggtgccggttcgcagatcctgcgcgacctcggcgtgcgcaagatgcgc
ctgctgagtgcgccgatgcgcttcaatgcgatatccggtttcgacctggaagttgtagaa
tacctgcccgccgaataa

DBGET integrated database retrieval system