KEGG   Pseudomonas aeruginosa PAO1: PA4053
Entry
PA4053            CDS       T00035                                 

Gene name
ribE
Definition
(RefSeq) 6,7-dimethyl-8-ribityllumazine synthase
  KO
K00794  6,7-dimethyl-8-ribityllumazine synthase [EC:2.5.1.78]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00740  Riboflavin metabolism
pae01100  Metabolic pathways
pae01110  Biosynthesis of secondary metabolites
pae01240  Biosynthesis of cofactors
Module
pae_M00125  Riboflavin biosynthesis, plants and bacteria, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:pae00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    PA4053 (ribE)
Enzymes [BR:pae01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.78  6,7-dimethyl-8-ribityllumazine synthase
     PA4053 (ribE)
SSDB
Motif
Pfam: DMRL_synthase
Other DBs
NCBI-GeneID: 879081
NCBI-ProteinID: NP_252742
UniProt: Q9HWX5
Position
complement(4534116..4534592)
AA seq 158 aa
MTLKTIEGTFIAPKGRYALVVGRFNSFVVESLVSGAVDALVRHGVAESEITIIRAPGAFE
IPLVTQKVAQQGGFDAIIALGAVIRGGTPHFEYVAGECTKGLAQVSLQFGIPVAFGVLTV
DSIEQAIERSGTKAGNKGAEAALSALEMVSLLAQLEAK
NT seq 477 nt   +upstreamnt  +downstreamnt
atgaccctgaagaccatcgaaggtaccttcattgcccccaaaggccgctacgccctggtg
gtcggccgcttcaacagcttcgtcgtggaaagcctggtcagcggcgccgtcgacgccctg
gtccgccacggcgtggctgaaagcgagatcaccatcatccgcgccccgggtgccttcgag
atcccgctggtgacccagaaggtcgcccagcaaggcggcttcgacgccatcatcgccctc
ggcgcggtgatccgtggcggcaccccgcacttcgaatacgtggctggcgagtgcaccaag
ggcctggcccaggtgtccctgcagttcggcatcccggtcgccttcggcgtcctcaccgtc
gactccatcgagcaggccatcgagcgctccggcaccaaggccggcaacaagggcgccgaa
gccgcgctgtcggccctggaaatggtcagcctgctggcgcagttggaggccaagtga

DBGET integrated database retrieval system