KEGG   Pseudomonas aeruginosa PAO1: PA4056
Entry
PA4056            CDS       T00035                                 

Gene name
ribD
Definition
(RefSeq) riboflavin-specific deaminase/reductase
  KO
K11752  diaminohydroxyphosphoribosylaminopyrimidine deaminase / 5-amino-6-(5-phosphoribosylamino)uracil reductase [EC:3.5.4.26 1.1.1.193]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00740  Riboflavin metabolism
pae01100  Metabolic pathways
pae01110  Biosynthesis of secondary metabolites
pae01240  Biosynthesis of cofactors
pae02024  Quorum sensing
Module
pae_M00125  Riboflavin biosynthesis, plants and bacteria, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:pae00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    PA4056 (ribD)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PA4056 (ribD)
Enzymes [BR:pae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.193  5-amino-6-(5-phosphoribosylamino)uracil reductase
     PA4056 (ribD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.26  diaminohydroxyphosphoribosylaminopyrimidine deaminase
     PA4056 (ribD)
SSDB
Motif
Pfam: RibD_C dCMP_cyt_deam_1 MafB19-deam
Other DBs
NCBI-GeneID: 879079
NCBI-ProteinID: NP_252745
UniProt: Q9HWX2
Position
complement(4536921..4538042)
AA seq 373 aa
MNAADPLYMARALELARQGLYSTQPNPRVGCVLVKDGQVVGEGWHVRAGEPHAEVHALRQ
AGENARGATAYVTLEPCSHFGRTPPCADALVGAGVARVVAAMQDPNPEVAGRGLLRLMQA
GIAVQSGVLEAEARELNIGFIKRMEHGLPFVRVKLAMSLDGRTAMASGESQWITGPSARS
AVQRLRARSSVVLSGADTLLADDARLNVRPDELGLNAELTALAAARQPLRVLVDGRLRVP
LESAFYQAGPALVATCAAASARERFQDAGHELLALPSAEGHVDLHKLLLELAARGANEVL
VEAGPRLAGAFARLGLVDEYRLFVAPKFLGSSARPLLDWPLARMADAAQLRIDDIRAVGD
DWLVTARPHLRDA
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgaacgccgccgacccgctgtacatggcccgcgccctggaactggcgcgccaggggctg
tactccacccagccgaatccgcgcgtcggctgcgtgctggtcaaggacggccaggtggtc
ggcgagggctggcacgtccgcgccggcgagccgcacgccgaggtccatgccctgcgccag
gccggcgagaatgcacgcggcgccaccgcctacgtgaccctcgagccctgcagccacttc
ggccgcaccccgccgtgcgccgatgcgctggtgggcgccggggtggcgcgggtggtcgcg
gcgatgcaggatcccaaccccgaggtcgccggtcgcggcctgctgcgtctgatgcaggcc
ggcatcgcggtgcagagcggcgtcctcgaagccgaggcgcgggaactcaacatcggtttc
atcaagcgcatggaacatggcctgccgttcgtccgggtcaagctggcgatgagcctggac
gggcgcaccgccatggccagcggggaaagccagtggatcaccgggccctccgcgcgttcg
gcggtgcagcgcttgcgcgctcgctccagcgtggtgttgtccggcgccgatacgctgctg
gcggacgatgcgcggctcaacgtacgccccgacgaactgggcctgaacgccgagcttacc
gcgctcgccgcggctcgccagccgttgcgggtgctggtcgacgggcgcctgcgggtgccg
ctggagtcggcgttctaccaggccggtccggcgctggtggcgacctgcgccgccgcctcg
gcgcgcgaacgcttccaggacgccggccacgaactgctggcgctgccctccgccgagggc
cacgtcgatttgcacaagctgctcctggaactggcggcgcgcggcgccaacgaagtgctg
gtggaggccggcccgcgtctggccggcgccttcgcccggctggggctggtggatgagtac
cggctgttcgtcgcgccgaagttcctcggctccagcgcccgtcctttgctcgattggccg
ctggcgcggatggccgatgcggcgcagttgcggatcgacgacatccgcgcggtgggcgac
gactggctggtcaccgcgcggccccatctgcgggacgcctga

DBGET integrated database retrieval system