KEGG   Pseudomonas aeruginosa PAO1: PA4092
Entry
PA4092            CDS       T00035                                 

Gene name
hpaC
Definition
(RefSeq) 4-hydroxyphenylacetate 3-monooxygenase small subunit
  KO
K00484  flavin reductase (NADH) [EC:1.5.1.36]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00350  Tyrosine metabolism
pae00740  Riboflavin metabolism
pae01100  Metabolic pathways
pae01120  Microbial metabolism in diverse environments
pae01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pae00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    PA4092 (hpaC)
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    PA4092 (hpaC)
Enzymes [BR:pae01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.36  flavin reductase (NADH)
     PA4092 (hpaC)
SSDB
Motif
Pfam: Flavin_Reduct
Other DBs
NCBI-GeneID: 878735
NCBI-ProteinID: NP_252781
UniProt: Q9HWT6
Position
4575332..4575844
AA seq 170 aa
MSQLEPRQQAFRNAMAHLSAAVNVITSNGPAGRCGITATAVCSVTDSPPTLMLCINRNSE
MNTVFKANGRLCVNVLSGEHEEVARHFAGMTEVPMERRFALHDWREGLAGLPVLHGALAN
LQGRIAEVQEIGTHSVLLLELEDIQVLEQGDGLVYFSRSFHRLQCPRRAA
NT seq 513 nt   +upstreamnt  +downstreamnt
atgtcccagctcgaacccaggcagcaagccttccgcaacgccatggcgcatctttcggcg
gcggtcaacgtgatcaccagcaacggcccggccggacgctgcgggatcaccgccaccgcg
gtctgctcggtcaccgacagcccgccgacgctgatgctctgcatcaaccgcaacagcgag
atgaacacggtgttcaaggccaacggtcgactctgcgtgaacgtcctcagcggcgaacat
gaagaggtggcccgccacttcgccggcatgaccgaggtcccgatggaacgccgcttcgcc
ctccacgactggcgcgagggcctcgccgggttgccggtgctgcacggcgccctggccaac
ctgcagggacgcatcgccgaggtccaggagatcggcacccactcggtgctgttgctggaa
ctggaggacatccaggtcctcgaacagggcgacggcctggtctacttcagccgcagcttc
catcgcctgcaatgcccccggcgggcggcctga

DBGET integrated database retrieval system