KEGG   Pseudomonas aeruginosa PAO1: PA4097Help
Entry
PA4097            CDS       T00035                                 

Definition
(RefSeq) alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PA4097
Enzymes [BR:pae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     PA4097
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     PA4097
    1.1.1.-  
     PA4097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 DZR
Motif
Other DBs
NCBI-GeneID: 878703
NCBI-ProteinID: NP_252786
UniProt: Q9HWT1
Position
4579510..4580568
Genome map
AA seq 352 aa AA seqDB search
MKALRWHAARDLRLSELERQAPRPGEVELEVAYCGICGSDLHEYQSGPHSIPQAEAHPLS
GCRAPLTLGHEFCGVVAALGPGVEGPRIGDRVAVEPEYRCGECRYCREGRYNLCESMGFI
GLMGDGGFAERARVPAYMLHRLPDAVGFRQAAVLEPAAVALHALRRSSLAPGQRCAVFGL
GPIGLLLVMLARLRGIEDIAAVDVSPERLALAGEFGASRALDARDGDTAARLREGGALDC
AFEAAGSQASLDAALASLRKGGELVLVSLMGEVRLDAFDLVNRELRLLGSVGYRDAYPEL
IALLADGRLDLARAVTRSVPLEQAVEHGFEALLRDKSQLKVLVNPNPALADA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcactgcgctggcacgccgcccgcgacctccgcctgagcgaactggaacgccag
gcgccgcggcccggcgaagtcgaactggaagtcgcctactgcggcatctgcggcagcgac
ctgcacgaataccagagcggcccgcactcgattccccaggccgaggcgcacccgctgtcc
ggttgccgcgcgccgctgaccctcggccatgagttctgcggcgtggtcgccgcgctcggc
cctggcgtggagggaccgcgcatcggcgaccgcgtcgcggtggagccggaataccgctgc
ggcgaatgccgctactgccgggaaggccgctacaacctctgcgagtcgatgggcttcatc
ggcctgatgggcgacggcggcttcgccgagcgcgcgcgggtgccggcctacatgctgcac
cgcctgccggacgcggtgggcttccgccaggccgccgtgctcgaaccggccgccgtggcc
ctgcacgcgctgcgccgcagcagcctggcgccgggccagcgctgcgcggtgttcgggctt
ggcccgatcggtctgctgctggtgatgctcgcccgcctgcgcggaatcgaggacatcgcc
gcggtcgacgtcagtcccgagcgcctcgccctagccggcgaattcggcgccagccgggcg
ctcgacgcccgtgacggcgacacggcggcgcgcctgcgcgaaggcggcgcgctcgattgc
gccttcgaggccgccggcagccaggccagcctcgacgccgccctggccagcctgcgcaag
ggtggcgagctggtgctggtgagcctgatgggcgaggtcaggctggacgccttcgacctg
gtcaaccgcgaactgcgcctgctcggcagcgtcggctaccgcgacgcctacccggagctg
atcgccctgctcgccgatggccgcctcgacctggcccgcgcagtgacccgcagcgtgccc
ctggagcaggccgtcgagcacggtttcgaggccctgctgcgcgacaaatcgcagctcaag
gtgctggtcaatcccaacccggccctggccgacgcctga

DBGET integrated database retrieval system