KEGG   Pseudomonas aeruginosa PAO1: PA4218
Entry
PA4218            CDS       T00035                                 
Name
(RefSeq) transporter
  KO
K08218  MFS transporter, PAT family, beta-lactamase induction signal transducer AmpG
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pae00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    PA4218
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pae02000]
    PA4218
Transporters [BR:pae02000]
 Major facilitator superfamily (MFS)
  Protein transporters
   Peptide-acetyl-CoA transporter (PAT) [TC:2.A.1.25]
    PA4218
SSDB
Motif
Pfam: Acatn MFS_1 BT1 DUF2070
Other DBs
NCBI-GeneID: 880532
NCBI-ProteinID: NP_252908
UniProt: Q9HWG8
Position
complement(4721614..4722858)
AA seq 414 aa
MLELYRHRRLVITLALLYLSQGIPIGLAMDALPTLLRQDGAPLQALAFLPLVGLPWVVKF
LWAPWVDNHWSRRLGRRRSWILPMQCMVLACLLGLATLGLGVASAGWAVGLLALASLASA
TQDIATDGMAAEHFSGELLAKVNAVQIAGVMIGFFGGGAGSLILAGHFGQRTAFLVMACV
PLASLCCVLALGRGDPHELPPAPAAKASLLRFLRRPLAPSLLALALLSAMTAVSGFGLSK
LYLSDAGWALQDIGRLGMSGGLVTVFLGCGGGAWLVRRIGLWRGFALGVVLAGCSALLWY
LQAGRWLALSEGLAWTCVLIGSLATGITSVAILTAAMRFAGQGGQAGTDVTAVQSTRDLG
EMLASSFLVSLTAQIGYAGGFLTGSALAVLALLLALRLQAGEGRGEWKGRAEEA
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgcttgagctgtaccgccaccgccgcctggtcatcaccctggcgttgctctacctgtcc
cagggcattcccatcggcctggccatggacgccctgcccaccctcctgcgccaggatggc
gcgccattgcaggcgctggccttcctgcccctggtggggctgccctgggtggtcaagttc
ctctgggcaccctgggtcgacaatcactggtcgcgccgtctcggccggcggcgtagctgg
atcctgccgatgcaatgcatggtcctcgcctgcctgctcggcctggcgacgctcggcctc
ggcgtggccagtgccggttgggcggtcggcctgctggcgctggcttcgctggccagcgcg
acccaggacatcgccaccgacggcatggcggcggagcacttcagcggcgagctgctggcc
aaggtcaacgcggtacagatcgccggggtgatgatcggcttcttcggcggcggcgccggc
agcctgatcctcgccgggcatttcggccagcgcacggcgttcctggtcatggcctgcgtg
ccgctggcaagcctgtgctgcgtgctcgccctggggcgcggcgacccccacgaactcccc
ccggcaccggccgccaaggccagcctgctgcgcttcctgcgtcggccgctggcgccttcg
ctgctggcgctggcgctgctgtcggcgatgaccgcggtatccggcttcggcctgtccaag
ctgtacctcagcgatgccggctgggccttgcaggacatcggccggctgggcatgagcggt
ggcctggtcacggtattcctcggctgcggcggcggcgcctggctggtcaggcggatcggc
ctgtggcgcggtttcgcccttggcgtggtgctcgccggttgttcggcgctgctctggtat
ctgcaggccggtcgctggttggcactgagcgaaggattggcgtggacctgcgtgctgatc
ggctcgctggctaccggcatcacctcggtggcgatcctcaccgcggcgatgcgcttcgcc
ggccagggcggccaggccggcaccgatgtcaccgcggtgcagagcacccgagacctcggc
gagatgctggcgtcttcgttcctggtcagcctcaccgcgcagatcggctatgccggcggt
ttcctcaccggcagcgccctggcggtgctggccctgctgctcgccctgcgcctgcaggcc
ggcgaggggcgcggggagtggaaggggcgggcggaagaggcctga

DBGET integrated database retrieval system