KEGG   Pseudomonas aeruginosa PAO1: PA4370
Entry
PA4370            CDS       T00035                                 

Symbol
icmP
Name
(RefSeq) insulin-cleaving metalloproteinase outer membrane protein
  KO
K07231  putative iron-regulated protein
Organism
pae  Pseudomonas aeruginosa PAO1
Brite
KEGG Orthology (KO) [BR:pae00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    PA4370 (icmP)
SSDB
Motif
Pfam: Peptidase_M75
Other DBs
NCBI-GeneID: 881386
NCBI-ProteinID: NP_253060
UniProt: Q9HW32
Position
4898193..4899533
AA seq 446 aa
MTRMPLATASLLALAISLAGCGDDKKAEAPATPAASTQPAAPAAAPAAKVDEAAAKAVIK
NYADLAEATFADALSTAKDLQKAIDAFLAKPDAETLKAAKEAWFAARTPYSQSEAFRFGN
AIIDDWEGQVNAWPLDEGLIDYVAKDYQHALGNPGATANIVANTEIQVGEDKIDVKEITG
EKLASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGNRPATDYAQGKDCTGGHCDR
RAAYLKAVTDLLVSDLEYMAGQWKAGVADNYRAKLEAEPVDTGLRKMFFGMGSLSLGELA
GERMKVALEANSTEDEHDCFSDDTHHTLFFNGKSIRNIYLGEYKRIDGSVVKGPSLADLV
AKADAAANDTLKADLADTEAKLQAIVDSAEKDGVHFDQMIAPDNKDGQQKIRDAIAALVK
QTGAIEQAAGKLGIQDLKPDNADHEF
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgactcgtatgcccctggccaccgccagtctgctggccctcgccatctccctcgccggc
tgcggcgacgacaagaaagccgaagcgcccgcaacaccggcggccagcacgcagcccgcc
gcgcccgccgccgccccggccgccaaggtcgacgaggccgccgccaaggcggtgatcaag
aattacgcggacctcgccgaagccaccttcgccgatgccctgagcaccgccaaggacctg
cagaaagccatcgacgcgttcctcgccaagcctgacgcggagaccctgaaagccgccaag
gaagcctggttcgccgctcgtaccccttactcccagagcgaagccttccgcttcggcaac
gcgatcatcgacgactgggaaggacaggttaacgcctggccgctggacgaaggcctgatc
gactatgtcgccaaggactaccagcacgccctgggcaaccccggcgccaccgccaacatc
gtcgccaacaccgagatccaggtcggcgaagacaagatcgacgtcaaggaaatcaccggc
gagaaactggccagcctgaacgagctgggcggttccgaagccaacgtcgccaccggctac
cacgccatcgagttcctcctctggggccaagacctgaacggcaccggtcccggcgccggc
aaccgtcccgccaccgactatgcccagggcaaggactgcaccggcggccattgcgaccgt
cgtgccgcctacctgaaggccgtcaccgacctgctggtcagcgacctcgaatacatggcc
ggacagtggaaagccggcgtcgccgacaactaccgcgccaagctggaggccgaaccggtg
gataccggcctgcgcaagatgttcttcggcatgggcagcctgtccctcggcgaactggcc
ggcgagcgcatgaaggtcgcgctggaggccaactccaccgaagacgagcacgactgcttc
agcgacgacacccaccacaccctgttcttcaacggcaagagcatccgcaacatctacctc
ggcgagtacaagcgcatcgacggcagcgtggtcaagggcccgagcctggccgacctggtc
gccaaggccgacgccgccgccaacgacaccctgaaggccgacctggccgacaccgaggcc
aagctgcaggccatcgtcgacagcgccgagaaggatggcgtgcacttcgaccagatgatc
gctccggacaacaaggacggccagcagaagatccgcgacgccatcgccgccctggtcaag
cagaccggcgccatcgagcaggccgctggcaagctgggtatccaggacctgaagccggac
aacgccgaccacgagttctga

DBGET integrated database retrieval system