KEGG   Pseudomonas aeruginosa PAO1: PA4561
Entry
PA4561            CDS       T00035                                 

Gene name
ribF
Definition
(RefSeq) bifunctional riboflavin kinase/FMN adenylyltransferase
  KO
K11753  riboflavin kinase / FMN adenylyltransferase [EC:2.7.1.26 2.7.7.2]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00740  Riboflavin metabolism
pae01100  Metabolic pathways
pae01110  Biosynthesis of secondary metabolites
pae01240  Biosynthesis of cofactors
Module
pae_M00125  Riboflavin biosynthesis, plants and bacteria, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:pae00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    PA4561 (ribF)
Enzymes [BR:pae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.26  riboflavin kinase
     PA4561 (ribF)
   2.7.7  Nucleotidyltransferases
    2.7.7.2  FAD synthase
     PA4561 (ribF)
SSDB
Motif
Pfam: FAD_syn Flavokinase CTP_transf_like
Other DBs
NCBI-GeneID: 878195
NCBI-ProteinID: NP_253251
UniProt: Q9HVM3
Position
complement(5109806..5110744)
AA seq 312 aa
MQLLRGLHNLQPLAGGCVATIGNFDGVHLGHQAILARLRERSLELGVPSCVVIFEPQPRE
FFSPDSAPVRLTRLREKLELLRGQGVDVVLCLAFNRRLRELSAAEFVRQVLVDGLAVRHL
EVGDDFRFGCDRSGDFAFLVNASREQGFTVEAATTVELDGVRVSSTRVRQALAEGDLHLA
ERLLGRPFSLSGRVLHGQKLGRQLGSPTANIQLKRRKAPLNGVYLVSTLVDGQRCQGVAN
IGTRPSVNGDGRPHLEVHLLDFAGDLYGRHLQVTFHQKLRDEQRFASLEALKAAILADIA
AARAYWLGQPLD
NT seq 939 nt   +upstreamnt  +downstreamnt
atgcagctgcttcgcggactacacaacctgcagcccctggccgggggctgcgtcgccacc
atcggtaacttcgacggcgtccacctcgggcaccaggctatcctggcgcgtctgcgcgag
cgctcgctggagctgggcgtacccagctgcgtggtgattttcgagccgcagccgcgcgag
ttcttctcccccgattcggcgccggtgcgtctgacccgcctgcgcgagaaactcgagttg
ctgcgtgggcagggcgtcgacgtggtgctctgcctggccttcaaccgccgcttgcgcgag
ctgtcggcagccgagttcgtccgccaggtcctggtcgatggactggcggtgcggcatctt
gaagtgggcgacgatttccgtttcggctgcgaccgctccggtgacttcgccttcctggtg
aacgccagtcgcgagcaggggttcaccgtcgaggcggccaccaccgtcgaactggacggt
gtgcgggtgagcagcacgcgggtccgccaggccctggccgagggcgacctgcatctcgcc
gagcgccttctggggcgtcccttcagcctgagcggacgggtcctgcatggacagaaactc
ggccggcaactgggctcgcccacggccaacattcaactgaaacggcgcaaggcgccgttg
aacggcgtctacctggtcagtacgctggtcgatggccagcgttgccagggggtggcgaac
atcggcacccgcccttcggtgaacggcgacggccgtccccatctggaagtgcacctgctc
gatttcgccggcgatctatacggccggcatctgcaggtgaccttccaccagaagctgcgc
gacgagcagcgttttgcctccctggaggcactcaaggcggcgattctcgcggatatcgcc
gccgcccgggcctactggctgggccaaccgcttgattga

DBGET integrated database retrieval system