KEGG   Pseudomonas aeruginosa PAO1: PA4706
Entry
PA4706            CDS       T00035                                 
Name
(RefSeq) hemin importer ATP-binding subunit
  KO
K10834  heme transport system ATP-binding protein [EC:7.6.2.5]
Organism
pae  Pseudomonas aeruginosa PAO1
Brite
KEGG Orthology (KO) [BR:pae00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pae02000]
    PA4706
Enzymes [BR:pae01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.5  ABC-type heme transporter
     PA4706
Transporters [BR:pae02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Heme transporter
    PA4706
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_16 AAA_29 AAA_23 AAA_27 RsgA_GTPase AAA_30 MMR_HSR1 DO-GTPase2 AAA_33
Other DBs
NCBI-GeneID: 881536
NCBI-ProteinID: NP_253394
UniProt: O68877
Position
complement(5285268..5286035)
AA seq 255 aa
MLRVENLSIRRGGKTVLEGLELELRPGEMLGVLGPNGAGKSTLLGALCGELEPAEGLVLL
DERGLDDWPGVARAQRLAVLPQSSSLGFAFPVEAVVGFGRLPHSSGRERDVQIVAEALAA
ADASHLAGRSYLALSGGERQRVHLARVLAQLWPGEPGQVLLLDEPTSALDPLHQHTTLQA
VHDFARRGASVLVILHDLNLAARYCDRLLLLQNGRPHLLGTPEEVLRPEPLRAVFGLEVL
VQRHPERGHPLIVAR
NT seq 768 nt   +upstreamnt  +downstreamnt
atgctgcgcgtggagaacctgtccatccgccgtggcggaaagactgtactggaaggcctc
gaactggagctgcggcctggcgagatgctcggcgtactcggccccaacggcgctggcaag
agcaccttgcttggcgctctctgtggcgaactggagccggccgaagggctggtgctgctc
gacgagcgcggcctcgacgactggccgggcgtcgctcgcgcgcagcgcctggcggtgctg
ccgcagagttcgtcgctgggcttcgcctttccggtggaggcggtggtcggcttcggtcgg
ctgccccattccagcggccgcgagcgcgatgtgcagatcgtcgccgaggccttggcggcg
gccgacgccagccatctggccgggcgcagctacctggcgctgtccggcggcgaacgccag
cgcgtgcacctggcgcgggtgctggcgcagctgtggccgggcgagccggggcaggtgctg
ctgctcgacgaaccgacctcggcgctcgacccgctgcaccagcacaccaccctgcaggcg
gtgcatgatttcgcccgccgcggtgcctcggtgctggtgatcctccacgatctcaacctg
gccgcgcgctattgcgaccgcctgctgctgttgcagaatggtcgcccgcacctgctcggt
acgcccgaggaagtcctgcgccccgagccgttgcgcgcggtgttcggcctcgaggtcctg
gtccagcgtcatcccgagcgaggtcatccgctgatcgtcgcccgttga

DBGET integrated database retrieval system