KEGG   Pseudomonas aeruginosa PAO1: PA4747Help
Entry
PA4747            CDS       T00035                                 

Gene name
secG
Definition
(RefSeq) preprotein translocase subunit SecG
  KO
K03075  preprotein translocase subunit SecG
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae02024  Quorum sensing
pae03060  Protein export
pae03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pae00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    PA4747 (secG)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PA4747 (secG)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PA4747 (secG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pae02044]
    PA4747 (secG)
Secretion system [BR:pae02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   PA4747 (secG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecG
Motif
Other DBs
NCBI-GeneID: 881707
NCBI-ProteinID: NP_253435
UniProt: Q9HV52
Position
complement(5332354..5332743)
Genome map
AA seq 129 aa AA seqDB search
MLEKVVIVVHLLMALGLVGLILVQHGKGADAGASFGAGASATVFGSQGSATFLSRITGIL
AAVFFLTSLGLAYFAKEKSDALQHIGLPDPAVLEQKQEKAPAADDVPVLQEQSKPAESAG
DVPAAPEQK
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgctggaaaaggtcgtaattgtcgtgcatctgctgatggcattgggtcttgttggcctg
atcctcgttcagcatggcaagggtgcggatgcaggggcttctttcggtgcaggtgcttcg
gcaactgttttcggaagccaaggttccgctacctttttgagtcggattactggtatactg
gcagcggtttttttcttgaccagccttggcttagcgtacttcgctaaagaaaagtctgat
gctctgcaacacatcggactgccggatccggcagttctggagcagaagcaagagaaagca
ccggccgctgacgatgtgccggttcttcaggagcagtccaagcctgcggaaagtgcaggc
gatgtaccggcggctcctgaacagaagtaa

DBGET integrated database retrieval system