KEGG   Pseudomonas aeruginosa PAO1: PA4922Help
Entry
PA4922            CDS       T00035                                 

Gene name
azu
Definition
(RefSeq) azurin
Organism
pae  Pseudomonas aeruginosa PAO1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Copper-bind
Motif
Other DBs
NCBI-GeneID: 878046
NCBI-ProteinID: NP_253609
UniProt: P00282
Structure
PDB: 

Position
complement(5521664..5522110)
Genome map
AA seq 148 aa AA seqDB search
MLRKLAAVSLLSLLSAPLLAAECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLP
KNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVS
KLKEGEQYMFFCTFPGHSALMKGTLTLK
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgctacgtaaactcgctgcggtatccctgctgtccctgctcagtgcgccactgctggct
gccgagtgctcggtggacatccagggtaacgaccagatgcagttcaacaccaatgccatc
accgtcgacaagagctgcaagcagttcaccgtcaacctgtcccaccccggcaacctgccg
aagaacgtcatgggccacaactgggtactgagcaccgccgccgacatgcagggcgtggtc
accgacggcatggcttccggcctggacaaggattacctgaagcccgacgacagccgtgtc
atcgcccacaccaagctgatcggctcgggcgagaaggactcggtgaccttcgacgtctcc
aagctgaaggaaggcgagcagtacatgttcttctgcaccttcccgggccactccgcgctg
atgaagggcaccctgaccctgaagtga

DBGET integrated database retrieval system