KEGG   Pseudomonas aeruginosa PAO1: PA5088
Entry
PA5088            CDS       T00035                                 
Name
(RefSeq) hypothetical protein
  KO
K07126  uncharacterized protein
Organism
pae  Pseudomonas aeruginosa PAO1
Brite
KEGG Orthology (KO) [BR:pae00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    PA5088
SSDB
Motif
Pfam: Sel1
Other DBs
NCBI-GeneID: 882244
NCBI-ProteinID: NP_253775
UniProt: Q9HU95
Structure
Position
complement(5726357..5727238)
AA seq 293 aa
MMRPLCFFLLIFLLSGNPVMAAELRPFICVNEKDHLPSLDPQADAWYREAVALAKPDTLR
PWDRIVDLYSKAVERGHWKAMHNLASLYRTGWPGGVEKDTQKALDLYQKMIDLKVPQGFY
DMAAMIGNRAGVKNPATDGLTFLDKAASLGNPPALTELGRLYIYVAGQDELGLKYTNCAA
GQGYAPANYELAMYYRLVAHNYPKAAGYYLLAASQGNDDAAFFMSGVFDKTSPDVDRMWY
APDEKLHKLYDGIYDQLAADPDLRFPNLIKDHPLPPHPTQGYDADRPDWKPGQ
NT seq 882 nt   +upstreamnt  +downstreamnt
atgatgcgtccattatgtttttttctcttgatttttttgttgtcgggaaatcctgtcatg
gcggctgaactacgaccttttatatgcgttaacgaaaaagaccacttgccatctctagat
cctcaggctgatgcatggtatcgggaggcagtagctctcgccaagcccgataccctgcgt
ccctgggatcgtatcgtcgatctatacagtaaggcagttgagcgtggtcactggaaggct
atgcataacttggcgagcctctatcgtaccggttggccaggcggtgtggagaaggatact
cagaaagctctagatctctaccagaagatgatcgatttgaaggttcctcaaggtttctac
gatatggcggcaatgatcggaaatcgtgctggcgtcaagaatcctgcgactgatggactt
acctttctcgataaggctgcaagcttgggtaatccaccagcattaactgagttaggaagg
ctatatatatatgttgctggtcaggatgagttggggctgaaatatacgaactgtgctgca
ggccagggctatgctcctgccaattacgagttggcgatgtactatcgtttggtggcacat
aactacccaaaggcggcaggctattaccttcttgctgcaagccaaggaaatgatgatgct
gccttcttcatgtccggagtttttgataagactagtcccgatgttgacagaatgtggtac
gcccccgatgagaagctgcacaaactatatgatggtatttacgatcaacttgccgctgat
cctgatttgcgttttcccaacttgataaaggaccatcctctgcctcctcacccgacccag
ggctacgacgcagatcggcccgactggaaaccggggcagtga

DBGET integrated database retrieval system