KEGG   Pseudomonas aeruginosa PAO1: PA5163
Entry
PA5163            CDS       T00035                                 

Gene name
rmlA
Definition
(RefSeq) glucose-1-phosphate thymidylyltransferase
  KO
K00973  glucose-1-phosphate thymidylyltransferase [EC:2.7.7.24]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00521  Streptomycin biosynthesis
pae00523  Polyketide sugar unit biosynthesis
pae00525  Acarbose and validamycin biosynthesis
pae00541  O-Antigen nucleotide sugar biosynthesis
pae01100  Metabolic pathways
pae01110  Biosynthesis of secondary metabolites
Module
pae_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:pae00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    PA5163 (rmlA)
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    PA5163 (rmlA)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PA5163 (rmlA)
   00525 Acarbose and validamycin biosynthesis
    PA5163 (rmlA)
Enzymes [BR:pae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.24  glucose-1-phosphate thymidylyltransferase
     PA5163 (rmlA)
SSDB
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Other DBs
NCBI-GeneID: 879990
NCBI-ProteinID: NP_253850
UniProt: Q9HU22
Structure
PDB: 

Position
5812241..5813122
AA seq 293 aa
MKRKGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDT
PRFQQLLGDGSNWGLDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHDFHE
LLGSASQRQTGASVFAYHVLDPERYGVVEFDQGGKAISLEEKPLEPKSNYAVTGLYFYDQ
QVVDIARDLKPSPRGELEITDVNRAYLERGQLSVEIMGRGYAWLDTGTHDSLLEAGQFIA
TLENRQGLKVACPEEIAYRQKWIDAAQLEKLAAPLAKNGYGQYLKRLLTETVY
NT seq 882 nt   +upstreamnt  +downstreamnt
atgaaacgcaagggcatcatcctcgccggaggctcgggcacccgcctgcacccggcaacg
ctggccatctccaagcagttgctgccggtgtacgacaagccgatgatctactacccgctc
agtaccctgatgctggcgggcatccgcgagatactgatcatctcgaccccacaggacacc
ccacgcttccagcagttgctgggcgacggttcgaactggggcctggacctgcaatatgcc
gtgcaaccgtcgccggacggcctggcccaggccttcctgatcggcgagtcgttcatcggc
aacgacctcagcgcgctggtcctgggcgacaacctctattacggccacgacttccacgag
ttgctcggcagcgcttcgcagcgccagaccggcgccagtgtcttcgcctaccacgtgctg
gacccggagcgctacggcgtggtcgagttcgaccagggcggcaaggccatcagcctggaa
gagaagccactggagccgaagtcgaactacgcggtcaccggcctgtatttctacgaccag
caggtggtggacatcgccagggacctgaagccttcgccgcgcggcgagctggagatcacc
gacgtcaaccgcgcctatctggagcgcggccagctcagcgtggagatcatgggccgcggc
tacgcctggctggataccggcacccacgattcgctgctcgaggccggccagttcatcgcc
accctggagaaccgccagggtctcaaggtggcctgcccggaagagatcgcctaccggcag
aagtggatcgacgccgcgcaactggaaaaactcgccgcgccgctggccaagaacggctac
ggccaatacctcaagcgcctgctgaccgagaccgtgtactga

DBGET integrated database retrieval system