KEGG   Pseudomonas aeruginosa PAO1: PA5267
Entry
PA5267            CDS       T00035                                 

Gene name
hcpB
Definition
(RefSeq) secreted protein Hcp
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae02025  Biofilm formation - Pseudomonas aeruginosa
pae03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pae00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PA5267 (hcpB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PA5267 (hcpB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pae02044]
    PA5267 (hcpB)
Secretion system [BR:pae02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PA5267 (hcpB)
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-GeneID: 879579
NCBI-ProteinID: NP_253954
UniProt: Q9HI36
Structure
PDB: 
3HE1

Position
complement(5932877..5933395)
AA seq 172 aa
MATPAYMSITGTKQGLITAGAFTEDSVGNTYQEGHEDQVMVQGFNHEVIIPRDPQSGQPT
GQRVHKPVVITKVFDKASPLLLAALTSGERLTKVEIQWYRTSAAGTQEHYYTTVLEDAII
VDIKDYMHNCQDPGNAHFTHLEDVHFTYRKITWTHEVSGTSGSDDWRSPVAG
NT seq 519 nt   +upstreamnt  +downstreamnt
atggcaacccccgcctatatgtccatcaccggcaccaagcagggcctgatcaccgccggc
gccttcaccgaggattcggtcggcaacacctaccaggaaggccacgaggaccaggtgatg
gtccagggcttcaaccacgaagtgatcatcccgcgcgacccgcagtccggccagccgacc
ggccagcgcgtgcacaagccggtggtcatcaccaaggtcttcgacaaggcctcgcccctg
ctgctggccgccctgacctccggcgagcgcctgaccaaggtggagatccagtggtaccgc
acctccgccgccggcacccaggagcactactacaccaccgtcctggaagacgcgatcatc
gtcgacatcaaggactacatgcacaactgccaggacccgggcaacgcccacttcacccac
ctggaagacgtgcacttcacctaccgcaagatcacctggacccacgaagtctccggcacc
tccggctccgacgactggcgctccccggtcgccggctga

DBGET integrated database retrieval system