KEGG   Pseudomonas aeruginosa PAO1: PA5281
Entry
PA5281            CDS       T00035                                 

Definition
(RefSeq) hydrolase
  KO
K20862  FMN hydrolase / 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase [EC:3.1.3.102 3.1.3.104]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00740  Riboflavin metabolism
pae01100  Metabolic pathways
pae01110  Biosynthesis of secondary metabolites
pae01240  Biosynthesis of cofactors
Module
pae_M00125  Riboflavin biosynthesis, plants and bacteria, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:pae00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    PA5281
Enzymes [BR:pae01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.102  FMN hydrolase
     PA5281
    3.1.3.104  5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase
     PA5281
SSDB
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD Acid_PPase
Other DBs
NCBI-GeneID: 877915
NCBI-ProteinID: NP_253968
UniProt: Q9HTS3
Position
5945235..5945933
AA seq 232 aa
MSSLRLVTFDLDDTLWDVAPVMNNAEALLREWLASNAARLGPVPIEHLWAIRTRLLDREP
MLRHRLSELRRRILFHALLDAGYPQAEAESLAEAGFQVFLEARHRVTLFPEVHPTLEILA
DRFTLGVLTNGNADVRRLGLADYFRFALCAEELGVGKPDPTPFREALKRAGVEASAAIHI
GDHPSDDIAGARRAGMRAIWFNPSGKPWAGEEEPSAEIRSLAELPALLARLQ
NT seq 699 nt   +upstreamnt  +downstreamnt
atgagcagcctgcgactggtcaccttcgacctcgacgacaccctgtgggacgtcgccccg
gtgatgaacaacgccgaggccctgctccgcgaatggctggcgagcaacgccgcgcgcctg
ggtccggtacccatcgagcacctgtgggcgatccgcacccgcctgctggatcgcgagccg
atgctgcgccaccgtctcagcgagctgcgccggcgcatcctgttccatgctctgctcgac
gctggttatccacaggcggaggcggaaagcctggccgaggccggtttccaggtattcctc
gaagcgcgccaccgggtcaccctgtttcccgaggtccacccgaccctggagatcctcgcc
gaccgcttcaccctcggcgtgctcaccaacggtaacgccgacgtgcgccgcctgggcctg
gccgactacttccggttcgccctctgcgccgaagaactgggcgtcggcaagcccgacccg
acgccattccgcgaagccctgaagcgcgccggcgtcgaggcctcggcagcgatacacatc
ggcgaccaccccagcgacgacatcgccggagcgcgccgcgccggcatgcgtgccatctgg
ttcaacccaagcggcaagccctgggccggggaggaagagccgagcgcggagatccgcagc
ctcgccgagctgccggccctgctcgcccgcctgcaatga

DBGET integrated database retrieval system