KEGG   Pseudomonas aeruginosa PAO1: PA5376
Entry
PA5376            CDS       T00035                                 
Name
(RefSeq) ABC transporter ATP-binding protein
  KO
K02000  glycine betaine/proline transport system ATP-binding protein [EC:7.6.2.9]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:pae00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PA5376
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pae02000]
    PA5376
Enzymes [BR:pae01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.9  ABC-type quaternary amine transporter
     PA5376
Transporters [BR:pae02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Glycine betaine/proline transporter
    PA5376
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_16 RsgA_GTPase ABC_ATPase AAA_29 CBS
Other DBs
NCBI-GeneID: 880284
NCBI-ProteinID: NP_254063
UniProt: Q9HTI8
Position
complement(6053412..6054590)
AA seq 392 aa
MTAIRFDHVDVIFGTHTKEALKLLDQGLGRAEILKRTGQVLGVEDACLDVNRGEICVLMG
LSGSGKSSLLRCINGLNKVSRGKLLIEHEGSQVDIANCSPATLKAMRTKRIAMVFQKFAL
MPWLTVAENVGFGLEMQGRPAAERKKLIDEKLELVGLSQWRDKRPDSLSGGMQQRVGLAR
ALAMDGDILLMDEPFSALDPLIRQQLQDELLVLQRQLHKTIVFVSHDLDEALKIGTRIAI
MKDGRIIQHGKPEEIVLSPADDYVRTFVAHTNPLNVLCGQSLMRGLDQCIRQNDEICFDQ
GRDCWIGLSEGDVLKGARQGSNVIDLQRWRQGDPVEKLRREPTLVDVSIRMRDALQIRYQ
TGHKLVLQEQDRVVGVLGDSELYHALLGKNLG
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgaccgcgatccgattcgaccatgtggacgtcatcttcggcacccacaccaaggaagcc
ctgaagctcctcgaccagggcctcggccgcgccgagatcctcaagcgcaccggccaggtg
ctcggcgtcgaggacgcctgcctggacgtcaaccgcggcgagatctgcgtgctgatggga
ctttccggctccggcaagtcgagcctgctgcgctgcatcaacggcctgaacaaggtcagc
cgcggcaagctgctgatcgagcacgaaggttcgcaggtggacatcgccaactgctcgccg
gcgaccctcaaggccatgcgtaccaagcgcatcgccatggtgttccagaagttcgccctg
atgccctggctgacggtggccgagaacgtcggcttcggcctggagatgcagggccgcccg
gccgccgagcggaagaagctgatcgacgagaagctcgagctggtcggtctctcgcagtgg
cgcgacaagcgtcccgactcgctctccggcggcatgcagcagcgcgtcggcctggctcgc
gcgctggcgatggatggcgacatcttgctgatggacgaaccgttctcggccctcgacccg
ctgatccgccagcaattgcaggacgaactgctggtgctgcaacggcaactgcacaagacc
atcgtgttcgtcagccacgacctcgacgaggcgctgaagatcggcacccgcatcgcgatc
atgaaggacggccggatcatccagcacggcaagccggaagagatcgtgctgagccccgcg
gacgactacgtgcgtaccttcgtcgcccataccaacccgctcaacgtgctgtgcggccag
agcctgatgcgtggcctcgaccagtgcatccggcagaacgacgagatctgcttcgaccag
ggccgcgactgctggatcggtctcagcgaaggcgacgtgctcaagggcgcgcgccagggc
agcaacgtcatcgacctgcaacgctggcgccagggcgatccggtggagaagctgcgccgc
gaaccgaccctggtggatgtcagcatccgtatgcgcgatgccctgcagattcgctaccag
accggccacaagctggtccttcaggagcaggacagggtggtcggggtgctcggcgacagc
gagctgtatcacgcgttgctgggcaagaacctcggctga

DBGET integrated database retrieval system