KEGG   Pseudomonas aeruginosa PAO1: PA5378
Entry
PA5378            CDS       T00035                                 

Name
(RefSeq) hypothetical protein
  KO
K02002  glycine betaine/proline transport system substrate-binding protein
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:pae00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PA5378
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pae02000]
    PA5378
Transporters [BR:pae02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Glycine betaine/proline transporter
    PA5378
SSDB
Motif
Pfam: OpuAC Zn_ribbon_2
Other DBs
NCBI-GeneID: 878444
NCBI-ProteinID: NP_254065
UniProt: Q9HTI6
Position
complement(6055475..6056413)
AA seq 312 aa
MKGCKSWLLAVSLCAPLAAQAAEPESCASVRFADVGWTDITVTTAVTRQVLESLGYKTKV
NLLSVPVTYRSLANNDLDVFLGNWMPTMTNDIKQYAEKGTVETLRANLEGAKYTLAVPQY
VYDGGLRSFADIAKFSDKLGNKIYGIEPGNDGNRVAQSMIDKNAFELGKFKLVESSEAGM
LSQVQRAIRRNQWVVFLGWEPHPMNTRFQMKYLEGGDDFFGPNYGGATIYTNVRKGYAQE
CANVGQLLKNLSFTLEMENKLMDAVLNENKKPEEAAKAWLKDHPEQLDAWLAGVTTRDGQ
PAAAAAKLAFAK
NT seq 939 nt   +upstreamnt  +downstreamnt
atgaaaggttgcaagtcttggctgctggccgtgtctctgtgcgcaccgctggcagcccag
gccgcggagcccgaatcctgtgcgtcggtgcgtttcgccgacgtcggctggaccgacatc
acagtgaccactgcggtcacccgccaggtcctcgagtccctcggctacaagaccaaggtc
aatctgctctcggtgccggtgacctaccgctccctggccaacaacgacctcgacgtattc
ctgggcaactggatgcccaccatgaccaacgacatcaagcagtacgccgagaaaggtacg
gtcgagacactgcgcgccaacctggagggcgccaagtacaccctggcggttccccagtac
gtctacgacggcggcctgcgcagcttcgccgatatcgcgaagttctccgacaagctgggc
aacaagatctacggcatcgagccgggcaacgacggcaaccgcgtcgcccagagcatgatt
gacaagaacgccttcgaactgggcaagttcaagttggtggaatccagcgaggcgggcatg
ctctcgcaggtgcagcgggccatccggcgcaaccagtgggtggtgttcctcggctgggag
ccgcaccccatgaatacccgcttccagatgaagtacctggaaggcggcgacgacttcttc
ggccccaactatggcggcgcgaccatctacaccaacgtgcgcaagggctacgcccaggag
tgcgccaacgtcggccaactgctgaagaacctcagcttcaccctcgagatggagaacaag
ctgatggacgcggtactcaacgaaaacaagaaacccgaggaagccgctaaggcctggttg
aaggatcacccggaacagctggatgcctggctggccggtgtcaccacccgcgacgggcag
cctgccgcagccgcggccaagctggcgttcgccaagtag

DBGET integrated database retrieval system