KEGG   Pseudomonas aeruginosa PAO1: PA5421
Entry
PA5421            CDS       T00035                                 

Gene name
fdhA
Definition
(RefSeq) glutathione-independent formaldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00625  Chloroalkane and chloroalkene degradation
pae00680  Methane metabolism
pae01100  Metabolic pathways
pae01120  Microbial metabolism in diverse environments
pae01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pae00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    PA5421 (fdhA)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PA5421 (fdhA)
Enzymes [BR:pae01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     PA5421 (fdhA)
SSDB
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C AdoHcyase_NAD 2-Hacid_dh_C Pyr_redox_3
Other DBs
NCBI-GeneID: 880053
NCBI-ProteinID: NP_254108
UniProt: Q9HTE3
Structure
PDB: 
4JLW

Position
6101884..6103083
AA seq 399 aa
MSGNRGVVYLGPGKVEVQNIPYPKMQDPQGRQIDHGVILRVVSTNICGSDQHMVRGRTTA
PEGLVLGHEITGEVVEIGRGVETMKIGDLVSVPFNVACGHCRTCKEQHTGVCLTVNPARA
GGAYGYVDMGGWVGGQAEYVLVPYADFNLLKLPNREAAMEKIRDLTCLSDILPTGYHGAV
TAGVGPGSTVYIAGAGPVGLAAAASARLLGAAVVIVGDVNPTRLAHAKKQGFEIADLSKD
TPLHEQIAALLGEPEVDCAVDAVGFEARGHGHSGSQQEAPATVLNSLMGITRVAGKIGIP
GLYVTEDPGAVDAAAKHGALSIRFGLGWAKSHSFHTGQTPVMKYNRQLMQAIMWDRIKIA
DIVGVEVITLDDAPKGYGEFDAGVPKKFVIDPHNLFRAA
NT seq 1200 nt   +upstreamnt  +downstreamnt
atgtctggcaatcgtggtgtggtctatctcggcccgggcaaggtcgaggtgcagaacatt
ccctatccgaagatgcaggacccgcagggccggcagatcgaccacggggtgatcctgcgg
gtggtctccaccaacatctgcggctccgaccagcacatggtgcgcggccgcaccaccgcg
ccggaaggcctggtgctgggccacgagatcaccggcgaggtggtggagatcgggcgtggc
gtggaaaccatgaagatcggcgacctggtctcggtaccgttcaacgtcgcctgcggccac
tgccgtacctgcaaggaacagcacaccggcgtctgcctgacggtcaatccggcgcgtgcc
ggcggcgcctacggctacgtcgacatgggtggctgggtcggcggccaggccgaatacgtg
ctggtgccctacgccgacttcaacctgctgaaactgcccaaccgcgaagcggcgatggag
aagatccgcgacctgacctgcctttcggacatcctccccaccggctaccacggcgcggtc
accgccggcgtcggcccgggcagcacggtctacatcgccggcgccggtccggtcggcctg
gccgcggcggcctcggcacgcctgctcggcgcggcggtggtgatcgtcggcgacgtcaac
ccgacccgcctggcccacgccaagaaacagggcttcgagatcgccgacctgtccaaggac
accccgctgcacgaacagatcgccgctctgctgggcgagccggaggtcgactgcgcggtc
gatgcggtcggtttcgaggcgcgcggccacggccattcgggctcgcagcaggaagccccg
gccaccgtgctcaactcgctgatgggcatcacccgggtcgccggcaagatcggcattccc
ggcctgtacgtcaccgaagacccgggcgcagtggacgcggccgccaagcacggcgccctg
agcatccgcttcggcctgggctgggccaagtcgcacagcttccataccggccagaccccg
gtgatgaagtacaaccgccagctgatgcaggcgatcatgtgggaccggatcaagatcgcc
gacatcgtcggggtggaagtcatcaccctcgacgatgcgccgaaaggctatggcgagttc
gacgccggggtgccgaagaaattcgtcatcgacccacacaacctgttccgcgcggcctga

DBGET integrated database retrieval system