KEGG   Paenibacillus sp. FSL R7-0273: R70723_01330Help
Entry
R70723_01330      CDS       T03356                                 

Definition
(GenBank) cysteine methyltransferase
  KO
K00567  methylated-DNA-[protein]-cysteine S-methyltransferase [EC:2.1.1.63]
Organism
paea  Paenibacillus sp. FSL R7-0273
Brite
KEGG Orthology (KO) [BR:paea00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:paea03400]
    R70723_01330
Enzymes [BR:paea01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.63  methylated-DNA---[protein]-cysteine S-methyltransferase
     R70723_01330
DNA repair and recombination proteins [BR:paea03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   Direct repair
    R70723_01330
 Prokaryotic type
    R70723_01330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_binding_1
Motif
Other DBs
NCBI-ProteinID: AIQ44698
UniProt: A0A089KCL7
Position
294490..295014
Genome map
AA seq 174 aa AA seqDB search
MSLGGRAWTLWASAKGLIRVSYEQDQGQLPAGWLNLHAPSARLEENADVFAEMGVISLLE
RYFAGEAVSFGSLPLDLWGTAFQQEVWKGLLQIPHGSLATYRELAVQIGRPLAVRAVGAA
NGQNPVPVIVPCHRVIGANGTLTGYRGGLKLKQELLALEGITHVGAKGHERFAF
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
gtgagtctcgggggcagagcatggacactatgggcgagcgccaagggacttatccgtgta
tcgtatgaacaggatcagggacagcttccggcaggctggctgaatctccatgccccgtct
gcccggctggaggagaatgcagatgtttttgcggagatgggcgttatcagtctgcttgag
cgctatttcgcgggcgaagctgtcagcttcggcagtctgccgcttgatctgtggggaact
gcctttcagcaggaggtctggaaagggctgctgcagattcctcacgggagtctggctacc
tatagggagctggctgtacagatcggccgcccgcttgcggttcgtgcagtcggtgccgct
aacgggcagaatccggttccggttattgtgccatgccaccgggtcatcggggcgaatggc
acactgaccggctaccggggcgggctgaagctgaagcaggagctgctggcgctggaagga
attacacatgtgggggcgaagggtcatgaacgatttgctttttga

DBGET integrated database retrieval system