KEGG   Paenibacillus sp. FSL R7-0273: R70723_13135Help
Entry
R70723_13135      CDS       T03356                                 

Definition
(GenBank) thiamine biosynthesis protein ThiJ
  KO
K18199  cyclohexyl-isocyanide hydratase [EC:4.2.1.103]
Organism
paea  Paenibacillus sp. FSL R7-0273
Brite
KEGG Orthology (KO) [BR:paea00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    R70723_13135
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:paea01002]
    R70723_13135
Enzymes [BR:paea01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.103  cyclohexyl-isocyanide hydratase
     R70723_13135
Peptidases [BR:paea01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   R70723_13135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DJ-1_PfpI GATase
Motif
Other DBs
NCBI-ProteinID: AIQ46707
UniProt: A0A089KE86
Position
2966525..2967109
Genome map
AA seq 194 aa AA seqDB search
MKMAFILFDGVTFLDFAGFYDVIYRLGQFDAGQGLEWDICGLREEITDELGLTVKINRIK
PDLSEYDLIFVPGGLGTRKLRSDADFINWLQGAAGVPYKISVCTGSLLLGAAGFLENRSA
TTHPSAYELLAPYCSNVVKARIVQDGSVVTGGGVSASIDLGLYMLSMLAGDEAMLTVKQQ
IDYPYVTQGIVQRQ
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatggcctttattctttttgacggagtaacgtttctggatttcgccggcttttac
gatgtgatctaccggcttgggcagtttgatgctggacaaggcctggaatgggatatttgc
ggattgcgtgaggaaataacggatgaattggggttgacggtcaaaataaaccggattaag
ccggacttatcggagtatgatctgatttttgtgccgggcgggctggggacgaggaagctg
cggtctgatgctgatttcattaattggctacagggggcggccggggttccctataaaatc
tccgtatgtaccggctcgctgctgcttggtgctgccggctttctggagaaccgtagtgca
actacacacccgtcagcctatgagctgcttgcaccttactgctccaatgtggtcaaggcg
cggatcgttcaggacggcagcgttgttactggaggcggtgtctccgcatccattgacctg
gggctgtacatgctgtcaatgctggctggggatgaagctatgctcacggtgaagcagcag
attgattacccgtatgtgacacaaggaatcgtgcagcggcaataa

DBGET integrated database retrieval system