KEGG   Paenibacillus sp. FSL R7-0273: R70723_18690Help
Entry
R70723_18690      CDS       T03356                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
paea  Paenibacillus sp. FSL R7-0273
Pathway
paea00030  Pentose phosphate pathway
paea00480  Glutathione metabolism
paea01100  Metabolic pathways
paea01110  Biosynthesis of secondary metabolites
paea01120  Microbial metabolism in diverse environments
paea01130  Biosynthesis of antibiotics
paea01200  Carbon metabolism
Module
paea_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
paea_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:paea00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    R70723_18690
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    R70723_18690
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:paea04147]
    R70723_18690
Enzymes [BR:paea01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     R70723_18690
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     R70723_18690
Exosome [BR:paea04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   R70723_18690
  Exosomal proteins of colorectal cancer cells
   R70723_18690
  Exosomal proteins of bladder cancer cells
   R70723_18690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N CW_7
Motif
Other DBs
NCBI-ProteinID: AIQ47697
UniProt: A0A089KGZ6
Position
complement(4234427..4235965)
Genome map
AA seq 512 aa AA seqDB search
MESSTFVLFGATGDLAKRKIYPALYNLFADGKLSGPLSVIGLGRRELSNETFQAQVLDSL
RTFSRRPVKDSVELQRFLLAFEYSVLDVGRPEDYTKLLAHVQRREAKLGLSGNRMFYLSV
GPEFFGPIAANIHDSGLGDTTGWKRLIIEKPFGRDLQSARELNESLNAAFREEEIFRIDH
FLGKPMVQNLEVLKYSNPVLRALWQNRYIANVQITAAETVGVEERAGYYDKSGALRDMFQ
NHMLQLLMMMAMQLPKDSSPDDVRSKKRHVIRSVRPLLKDELAQNVVRGQYGAGQIKGKP
VPAYLSEPGIESSSQNDTYIAARLWIDDPMWSEVPFYIRTGKRLKEKSTRIVIEFKEPFN
DSHNVNRGKLPLEPNLLIIEIGPGEGISLQLNTKNPRQHGALEPVSIRHDSANPDLPEAY
ENLIYDALLGDATFFAHWEEVELSWQWVQPIIEAVEEGTLPLHTYAAGSYGPAAADELLG
EDHWWLDEPEGETDGSAEASGRVDEQAIRAGA
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
gtggaatcatctacctttgtactgtttggcgctaccggggatctggcgaaacgcaaaatc
tatccggcgctctataatctgtttgccgatggcaagctttccggtcctctctccgtaatt
ggcctgggcagaagagagcttagcaacgaaacgttccaggcgcaggtgctggattcgctg
cgtaccttttcccgccgtcctgtaaaggattcggtggagctgcagcgttttttgctggct
tttgaatatagcgtgctggacgttggacgtccggaggattacacaaagctgctggcccac
gtgcagcggcgggaagcgaagcttggactttcaggcaaccggatgttctatttgtcggtg
ggtccggaatttttcggaccgattgccgctaatattcacgacagcggtctgggagatacc
acaggctggaaacgtctgattatcgagaagccgttcggccgggatctgcagtccgcacgg
gagcttaatgagagtctgaatgcggctttccgtgaagaagaaatcttccggatcgaccat
ttcctcggcaagccgatggtccagaacctcgaagtgctcaagtactctaacccggtgctc
cgggcgttgtggcagaaccgatacatcgctaacgtccagatcacggctgccgagactgtc
ggagtggaggagcgggcaggctattatgacaaatccggtgcgctgcgcgacatgttccag
aaccatatgctacagctgctgatgatgatggcgatgcagctgcccaaggacagcagtccc
gacgatgtccgcagtaaaaaacgccatgttatccgctccgtacgtccgctgctgaaagac
gagctggcacagaatgtggtgcgcgggcaatacggtgcagggcaaattaaaggtaagccg
gtgccagcctaccttagcgagccgggcattgagtcctcctcacagaatgatacgtatatt
gccgcacggctgtggattgatgatccgatgtggagtgaagtaccattttatatccgcacc
ggcaaaaggctgaaggagaaatcgaccagaatcgttattgaattcaaggaaccgtttaat
gattctcataacgttaacagaggcaagcttccgcttgagccgaatctgctgatcattgaa
atcggccccggtgaaggtatttcactgcagctgaataccaaaaatccgcgccagcacgga
gcgcttgagccggtaagcataagacatgattcggccaatcccgatctgcccgaagcctat
gagaaccttatctatgatgcgctgcttggagatgcgaccttctttgcgcactgggaagag
gtggagctgagctggcagtgggtgcagccgattattgaggccgtagaggaaggcacgctt
ccgctccatacgtatgctgcgggttcatacggtccggctgcagcggatgagctgctgggc
gaagaccactggtggctggatgagcctgaaggtgaaacggacgggagtgctgaagcatcc
ggcagagtggatgagcaggcgatccgcgccggggcgtaa

DBGET integrated database retrieval system