KEGG   Paenibacillus sp. FSL R7-0273: R70723_22430Help
Entry
R70723_22430      CDS       T03356                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
paea  Paenibacillus sp. FSL R7-0273
Pathway
paea00450  Selenocompound metabolism
paea00970  Aminoacyl-tRNA biosynthesis
paea01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paea00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    R70723_22430
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    R70723_22430
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:paea01007]
    R70723_22430
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:paea03016]
    R70723_22430
Enzymes [BR:paea01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     R70723_22430
Amino acid related enzymes [BR:paea01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   R70723_22430
Transfer RNA biogenesis [BR:paea03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    R70723_22430
 Prokaryotic type
   Other AARSs
    R70723_22430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AIQ48364
UniProt: A0A089LUW4
Position
complement(4979379..4981406)
Genome map
AA seq 675 aa AA seqDB search
MSENKTFYLTTPIYYPSDKLHIGHAYSTVAGDAMARYKRLRGFEVRYLTGTDEHGQKIEE
KAAKAGKTPQEFVDGIVVGIKELWRKLDISNDDFIRTTEERHKTVVADIFDRLLQQGDIY
KGEYEGWYCISDETFYTETQLVDIERDADGNITGGKSPDSGHPVELVKEESYFFRMSKYA
DRLLRFYEENPEFILPESRKNEMINNFIKPGLEDLAVSRTTFDWGVKVKGDAKHVVYVWI
DALTNYITALGYGSADRSLYDKFWPADVHIVGKEIVRFHTIYWPIILMALGEPLPKKVFA
HGWLLMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGTFTPESFVDRVNY
DLANDLGNLLNRTGAMVGKYFGGELPAYAGKVTAFDGELEAAVESTYAKVEEAMEKMEFS
VALTAIGALISRTNKYIDETQPWVLAKDESRNGELASVMRHLVEGLRTASILLQPFLTGA
PAKIWEQLGIQPGELTTWDSGRTFGLIPAGTKLAKGEPIFPRLDVAVEVAYIAEAMGAGK
PAAAEPEAAPAAAAGDAPAAVEPEEEHKEEIGIDDFAKAELRVAQVIAAEPVKKADKLLK
LQLDLGYEQRQVVSGIAKFYTPEELVGRKVICIVNLKPVKLRGELSQGMILAASKGDQLT
IATVPDSMPNGAIVK
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagaacaaaacattttatctgacaacccctatctactatccgagcgataagctg
catatcggacatgcctattcgacagtggcgggtgatgcaatggcccgctataagcgtctg
cgcggctttgaggtacgttatctgaccggtactgatgagcatggccagaagattgaagag
aaagctgccaaggcgggcaagacgcctcaggagttcgttgacggcattgttgtaggcatc
aaggagctctggcgcaagctggacatttccaatgatgacttcatccgtactaccgaggaa
cgccataagacagtggttgcggatatttttgaccggctgctgcagcagggcgacatttac
aaaggtgaatacgagggctggtattgtatttcagacgaaaccttctataccgagacacag
ctggtggacattgagcgtgatgcggacggcaacattaccggcggcaaaagcccggacagc
ggacacccggttgagctggtgaaggaagaaagctatttcttccggatgagcaaatatgct
gatcgcctgctgaggttctatgaagagaatccggagttcattctcccggaatcgcgcaaa
aacgagatgatcaacaacttcattaagccgggtctggaggatcttgccgtttcccgtaca
acctttgactggggcgttaaggtaaaaggtgatgccaagcatgtagtgtatgtatggatc
gatgcgctcactaactacattactgccctcggttacggttctgctgaccgcagcctgtac
gacaagttctggccggcggatgtgcatattgtcggcaaggaaatcgtccggttccatacc
atctactggccaatcatcctgatggcgctgggtgagccgctgcctaagaaggtgtttgcc
cacggctggctgctgatgaaggacggtaaaatgtccaaatccaaaggcaatgttgtagat
ccggtgaccctgattgaccgttacggtctggatgcgctgcgttactacctgctgcgtgag
gttccatttggctcagacggtaccttcactccggaaagctttgttgaccgggtcaactac
gatctggcgaacgacctcggcaacctgctcaaccgtacaggagctatggtgggaaaatac
ttcggcggcgagctgccggcttacgctggtaaagtgactgcattcgacggcgagctggag
gctgctgttgagagcacctatgccaaggtagaggaagcgatggaaaagatggaattctcc
gttgcactgactgctatcggcgcgctgatcagccgcacgaacaaatatatcgacgaaacc
cagccttgggtactggctaaggatgagagcagaaacggcgagctggcctccgtcatgaga
cacctggtggaaggtctgcgcaccgcttcgattctgctgcagccgttcctgaccggtgct
ccggccaaaatctgggagcagctgggcattcagccgggtgagctgaccacctgggacagc
ggccgcaccttcggcctgattccggccggcacgaagctcgccaaaggcgagccgattttc
ccgcggcttgacgtagccgtggaggtggcgtacatcgccgaagcgatgggcgcaggcaag
ccggcggcagccgagcctgaggcggcaccagccgcagctgcgggtgatgctccggcggct
gtagagccggaggaagagcataaggaagaaatcggcatcgacgatttcgccaaggcggag
ctgcgcgtagcccaggttatcgcggctgagccggtgaaaaaggccgacaagctgctgaag
ctgcagctcgatctcggttatgagcagcgccaggtggtttccggcatcgcgaagttttac
acgccggaagagctggttggccgcaaggttatctgcatcgtcaacctgaagccggtgaag
ctgcgcggcgagctgtcccagggcatgattctggcagcctccaaaggcgaccagctgaca
atcgccactgtgccggacagcatgccgaacggagcaattgtgaagtaa

DBGET integrated database retrieval system