KEGG   Pseudomonas aeruginosa NCGM 1900: NCGM1900_0353Help
Entry
NCGM1900_0353     CDS       T03789                                 

Gene name
folA
Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
paeb  Pseudomonas aeruginosa NCGM 1900
Pathway
paeb00670  One carbon pool by folate
paeb00790  Folate biosynthesis
paeb01100  Metabolic pathways
Module
paeb_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:paeb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NCGM1900_0353 (folA)
   00670 One carbon pool by folate
    NCGM1900_0353 (folA)
Enzymes [BR:paeb01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     NCGM1900_0353 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: BAP19487
UniProt: A0A081HD68
Position
393633..394139
Genome map
AA seq 168 aa AA seqDB search
MARPLAMIAALGENRAIGIDNRLPWRLPADLKHFKAMTLGKPVIMGRKTWDSLGRPLPGR
LNLVVSRQAGLALEGAEVFASLDAALARAEAWAQAEDADELMLIGGAQLYAEALPRAARL
YLTRVGLAPEGDAFFPEIDGAAWRLASSIEHAAADDAPAYAFEVWERR
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atggcacgaccgctggcgatgatcgccgcccttggcgagaaccgcgcgatcggcatcgac
aaccgcctgccctggcgcctgccggccgacctcaagcatttcaaggcgatgaccctcggc
aagccggtgatcatggggcgcaagacctgggactcgctgggtcggccgctgccgggccgg
ctaaacctggtggtcagccgccaggccggcctggcactggagggtgcggaagtgttcgcc
agcctggacgccgcgctggcgcgcgccgaggcgtgggcgcaggcggaggacgccgacgaa
ctgatgctgatcggcggcgcccagctctatgccgaggccttgccgcgcgccgcgcgtctc
tacctgacccgggttggcctggcgccggagggcgacgcctttttccccgagatcgatggt
gcggcctggcgcctggcgtcgagcatcgaacacgccgcggctgacgatgcgcctgcctac
gccttcgaggtatgggagcgccgctga

DBGET integrated database retrieval system