KEGG   Pseudomonas aeruginosa NCGM 1900: NCGM1900_1966Help
Entry
NCGM1900_1966     CDS       T03789                                 

Definition
(GenBank) putative haloacid dehalogenase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
paeb  Pseudomonas aeruginosa NCGM 1900
Pathway
paeb00361  Chlorocyclohexane and chlorobenzene degradation
paeb00625  Chloroalkane and chloroalkene degradation
paeb01100  Metabolic pathways
paeb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:paeb00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NCGM1900_1966
   00361 Chlorocyclohexane and chlorobenzene degradation
    NCGM1900_1966
Enzymes [BR:paeb01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     NCGM1900_1966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like LPD22
Motif
Other DBs
NCBI-ProteinID: BAP21079
UniProt: A0A4U9L231
Structure
PDB: 

Position
2014775..2015476
Genome map
AA seq 233 aa AA seqDB search
MRAILFDVFGTLVDWRSSLIEQFQALERELGGTLPCVELTDRWRQQYKPAMDRVRNGQAP
WQHLDQLHRQSLEALAGEFGLALDEALLQRITGFWHRLRPWPDTLAGMHALKADYWLAAL
SNGNTALMLDVARHAGLPWDMLLCADLFGHYKPDPQVYLGACRLLDLPPQEVMLCAAHNY
DLKAARALGLKTAFIARPLEYGPGQSQDLAAEQDWDLIASDLPDLHRQLAASA
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgatcctgttcgatgtgttcggtaccctggtggactggcgttccagcctgatc
gagcagttccaggcgttggagcgcgaactcggcgggaccctgccctgcgtggaactgacc
gaccgctggcgccagcaatacaagccggcgatggaccgggtacgcaacggccaggcgccc
tggcagcacctcgaccagttgcaccggcagagtctcgaggctctggccggagagttcggc
ctggcgctggacgaggccctgctgcaacgcatcactggcttctggcaccgcctgcggccg
tggccggacacgctcgccgggatgcacgcgctgaaggccgactactggctcgccgcgctg
agcaacggcaacaccgcgctgatgctcgacgtcgcgcggcacgccgggctgccctgggac
atgctgctgtgcgccgacctgttcggccactacaagcccgacccgcaggtctacctcggc
gcctgccgcctgctcgacctgccgccgcaggaggtgatgctctgcgcggcgcacaactac
gacctcaaggccgcgcgcgccctcggcctgaagaccgcgttcatcgcccggccgctggaa
tacggccccggccagtcccaggacctcgccgccgagcaggactgggacctgatcgccagc
gacctgccggacctgcaccggcaactggcggcctcagcctga

DBGET integrated database retrieval system