KEGG   Pseudomonas aeruginosa NCGM 1900: NCGM1900_3969Help
Entry
NCGM1900_3969     CDS       T03789                                 

Definition
(GenBank) putative acyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
paeb  Pseudomonas aeruginosa NCGM 1900
Pathway
paeb00071  Fatty acid degradation
paeb00072  Synthesis and degradation of ketone bodies
paeb00280  Valine, leucine and isoleucine degradation
paeb00310  Lysine degradation
paeb00362  Benzoate degradation
paeb00380  Tryptophan metabolism
paeb00620  Pyruvate metabolism
paeb00630  Glyoxylate and dicarboxylate metabolism
paeb00640  Propanoate metabolism
paeb00650  Butanoate metabolism
paeb00900  Terpenoid backbone biosynthesis
paeb01100  Metabolic pathways
paeb01110  Biosynthesis of secondary metabolites
paeb01120  Microbial metabolism in diverse environments
paeb01130  Biosynthesis of antibiotics
paeb01200  Carbon metabolism
paeb01212  Fatty acid metabolism
paeb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:paeb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NCGM1900_3969
   00630 Glyoxylate and dicarboxylate metabolism
    NCGM1900_3969
   00640 Propanoate metabolism
    NCGM1900_3969
   00650 Butanoate metabolism
    NCGM1900_3969
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NCGM1900_3969
   00072 Synthesis and degradation of ketone bodies
    NCGM1900_3969
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NCGM1900_3969
   00310 Lysine degradation
    NCGM1900_3969
   00380 Tryptophan metabolism
    NCGM1900_3969
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NCGM1900_3969
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NCGM1900_3969
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NCGM1900_3969
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:paeb04147]
    NCGM1900_3969
Enzymes [BR:paeb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NCGM1900_3969
Exosome [BR:paeb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NCGM1900_3969
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAP23049
UniProt: A0A072ZN79
Position
4115017..4116207
Genome map
AA seq 396 aa AA seqDB search
MTREDPIVIVSAVRTPMGGFLGDFKDVNAATLGAAAVRAAVERARLQADEVDEAVLGCVL
AAGQGQAPARQAVLGAGLARGTPCSTLNKMCGSGMKALMLAHDTLLAGSAGVALAGGMES
MSNAPYLLERARSGYRMGHGKVLDHMFLDGLEDAYDKGRLMGTFAEDCAEAYGFTREAQD
EFAVASLTRAQQAMRDGRFQAEIVPLTVTAGKTERLVDSDEQPPKARLDKIPTLKPAFRE
GGTVTAANSSSISDGAAALVLMRLSEAERRGLAPLAAIRGHASFADAPNLFPTAPVGAVK
RLMQRTGWSLGEVDLFEVNEAFAVVGMAAMRDLDLSHERLNVHGGACALGHPIGASGARI
VVTLLNALQQYDLERGVAAVCIGGGEATAIAVERLR
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcgaagatccgatcgtcatcgtcagcgccgtccgcaccccgatgggcggcttc
ctcggcgacttcaaggacgtcaacgccgctaccctcggcgccgcggcggtgcgcgccgcg
gtggagcgggcgcgcctgcaagccgacgaagtggacgaggccgtgctcggctgcgtgctc
gccgccggccagggccaggcgccggcgcgccaggcggtgcttggcgccgggctggcgcgc
ggcacgccgtgctcgacgctgaacaagatgtgcggctcgggcatgaaggcgctgatgctc
gcccacgacacgttgctcgccggcagcgccggggtcgcgctggccgggggcatggaaagc
atgtccaacgcgccctacctgctggagcgcgcccgtagcggctaccgcatgggccacggc
aaggtgctcgaccacatgttcctcgacggcctcgaagacgcctacgacaagggccgcctg
atgggcaccttcgccgaggactgcgccgaggcctacggcttcacccgcgaggcacaggac
gagttcgccgtggcctcgctgacccgcgcgcagcaagccatgcgcgacggacgcttccag
gccgagatcgtgccgctgacggtcaccgccggcaagaccgagcgcctggtggatagcgac
gagcagccgccgaaggcccggctggacaagatcccgaccctgaagccggcgttccgcgaa
ggcggcacggtaaccgcggccaactccagttcgatttccgacggtgccgccgcgctggtc
ctgatgcgcctttccgaggccgagcgacgcgggctcgcgccgttggcggcgatccgtggg
catgcttcgttcgccgacgcgccgaacctgttccccaccgcgccggtcggtgcggtgaag
cgcctgatgcagcgtaccggctggtcgctgggcgaggtcgacctgttcgaggtcaacgaa
gccttcgccgtggtcggcatggcggcgatgcgcgacctcgacctgtcccacgaacgcctc
aacgtccacggcggcgcctgtgcgctgggccatccgatcggcgcgtccggcgcacggatc
gtcgtgaccctgctcaacgccctgcagcagtacgacctggaacgcggcgtggcggcggtc
tgcatcggcggcggcgaggcgaccgcgatcgccgtcgagcgcttgcgctga

DBGET integrated database retrieval system