KEGG   Pseudomonas aeruginosa NCGM 1900: NCGM1900_4480Help
Entry
NCGM1900_4480     CDS       T03789                                 

Gene name
maiA
Definition
(GenBank) maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
paeb  Pseudomonas aeruginosa NCGM 1900
Pathway
paeb00350  Tyrosine metabolism
paeb00643  Styrene degradation
paeb01100  Metabolic pathways
paeb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:paeb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    NCGM1900_4480 (maiA)
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    NCGM1900_4480 (maiA)
Enzymes [BR:paeb01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     NCGM1900_4480 (maiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C GST_C_3 Tom37 GST_N_4
Motif
Other DBs
NCBI-ProteinID: BAP23560
UniProt: A0A077K1T3
Position
4745854..4746492
Genome map
AA seq 212 aa AA seqDB search
MKLYTYYRSTSSYRVRIALALKGLDYQSLPVNLVRDGGEHRQPAYLALNPQGRVPALQVD
EGELLIQSPAIIEYLEERYPHPALLSSDPLRRAHERGVAALVGCDIHPLHNASVLNLLRQ
WGHDEEQVRQWIGHWVGQGLAAVEQLIGDQGWCFGDRPGLADVYLIPQLYAAERFGVALD
AWPRIRRVADLAAAHPAFRQAHPANQPDTPAA
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctatacctactaccgttccacctcctcctaccgggtgcgcatcgccctggcg
ctgaaggggctggactaccagtcgctgccggtcaacctggtccgcgacggcggcgaacac
cgccaacccgcctacctggcgctcaacccgcagggccgcgtaccggccctgcaggtcgac
gagggcgagctgctgatccagtcgccggcgatcatcgagtacctcgaggagcgctacccg
caccccgccctgctctccagcgatccgctgcgccgcgcccacgagcgcggagtcgcggcg
ctggtcggctgcgacatccacccgttgcacaacgccagcgtgctcaacctgctgcgccag
tggggacacgacgaagagcaggtccggcagtggatcggccactgggtcggccagggtctc
gccgccgtcgagcaactgatcggcgaccagggctggtgcttcggcgaccggccgggcctg
gccgacgtctacctgatcccgcagctctacgccgccgaacgcttcggcgtagcgctggac
gcctggccacggatccgccgggtcgccgacctggccgccgcccatccggcgttccgccag
gcccatccggccaaccagccggacaccccggccgcctga

DBGET integrated database retrieval system