KEGG   Pseudomonas aeruginosa NCGM 1900: NCGM1900_5287Help
Entry
NCGM1900_5287     CDS       T03789                                 

Definition
(GenBank) putative glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
paeb  Pseudomonas aeruginosa NCGM 1900
Pathway
paeb00480  Glutathione metabolism
paeb00590  Arachidonic acid metabolism
paeb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paeb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    NCGM1900_5287
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NCGM1900_5287
Enzymes [BR:paeb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     NCGM1900_5287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: BAP24359
UniProt: A0A071L8V9
Position
complement(5584344..5584898)
Genome map
AA seq 184 aa AA seqDB search
MKPRVLLSALALAGLPLSGWAADCPELLQGQLTKLRSKESIDLCQRYAGKPLVVVNTASH
CGFTPQFKGLEALYQRYKGQGLEVLGVPSDDFKQEAADTAETAKICYGNYGVTFAMTQPQ
HVRGDEAIPLFRQLAEQSGQAPRWNFYKYVVDRQGRVVAQFSSKTTPDDPQLQAAIEKAI
ASQP
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctcgcgtgctgttgtccgccctggcgctcgccgggctgccgctgagcggctgg
gccgccgattgcccggaactgctgcagggccagttgaccaagctgcgttccaaggaaagc
atcgatctttgccaacgttacgccggcaagccgctggtggtggtcaacactgccagccac
tgtggcttcaccccgcagttcaaggggctcgaggcgctctaccagcgttacaaggggcag
ggcctggaagtgctcggggtaccttccgacgacttcaagcaggaagccgcggataccgcc
gagaccgcgaagatctgctatggcaactacggcgtgaccttcgccatgacccagccgcag
cacgtgcgcggcgacgaggcgatcccgctgttccgccagttggccgagcagagcggccag
gcgccgcgctggaatttctacaagtacgtggtggatcgccagggcagggtggtcgcgcag
ttctccagcaagaccaccccggacgatccgcagctccaggccgccatcgagaaggccatc
gccagccagccctga

DBGET integrated database retrieval system