KEGG   Pseudomonas aeruginosa NCGM 1900: NCGM1900_6307Help
Entry
NCGM1900_6307     CDS       T03789                                 

Gene name
wbpW
Definition
(GenBank) GDP-mannose pyrophosphorylase
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
paeb  Pseudomonas aeruginosa NCGM 1900
Pathway
paeb00051  Fructose and mannose metabolism
paeb00520  Amino sugar and nucleotide sugar metabolism
paeb01100  Metabolic pathways
paeb01110  Biosynthesis of secondary metabolites
paeb01130  Biosynthesis of antibiotics
paeb02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:paeb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    NCGM1900_6307 (wbpW)
   00520 Amino sugar and nucleotide sugar metabolism
    NCGM1900_6307 (wbpW)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    NCGM1900_6307 (wbpW)
Enzymes [BR:paeb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     NCGM1900_6307 (wbpW)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     NCGM1900_6307 (wbpW)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase NTP_transf_3 Cupin_2 VEK-30
Motif
Other DBs
NCBI-ProteinID: BAP25361
UniProt: A0A231IDW1
Position
complement(6681366..6682805)
Genome map
AA seq 479 aa AA seqDB search
MLIPVVLSGGAGTRLWPVSREGQPKPFMRLPDGQTLLGKTYRRAAGLLAGHGEIVTVTNR
EHYFQSKDQFQAARLGRHRGHFILEPTGRNTAPAIAVAALALQAEHGDAAVLVVMPADHL
IRNEEAFREAVGHAARLAVAGHLVTFGVVPDAAETGFGYIELGDRLDEQGAAKVRRFVEK
PDEETARRYVESGGFLWNSGMFCFTASTLVDELAQHAPALLEQARACLAASAAVKMADGI
QHELAGEAFAALPDISIDYALMERSARVAVVPAAFDWSDIGSWGAMSALLDADAEGNRGS
GDTLFVDTRNTFVQSDGRLVATVGVDDLVVVDTSDALLIARADRVQEVRRVVQRLKDERH
EAYRLHRTVNRPWGSYTVLEEGPRFKIKRIVVRPGERLSLQMHHHRSEHWIVVQGMARVT
NGDGARLVNSNESTYIPAGHRHRLENPGVIDLVMIEVQSGEYLGEDDIVRFEDQYGRVV
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgctgattcccgtggtgctttccggcggcgccggtacccgcctttggccggtgtcgcgt
gaaggacagccgaagccgttcatgcgcctgcccgatggccagaccctgctgggcaagacc
taccgacgtgccgccgggctcctggccgggcatggcgaaatcgtcacggtgaccaaccgc
gagcattacttccagagcaaggaccagttccaggcggcccgcctggggcggcaccgggga
catttcatcctcgaaccgaccgggcgcaacaccgctccggcgattgccgtcgccgccctg
gcgctgcaagccgaacatggcgacgcggcggtactggtggtgatgccggcggatcacctg
atccgcaacgaggaggccttccgcgaggcggtggggcatgccgcgcgtctagccgtcgcc
gggcacctggttaccttcggcgtggtgccggacgcagcggaaaccggtttcggctatatc
gagctgggcgaccggctggacgagcagggggcggccaaggtgcgccgcttcgtcgagaaa
cccgatgaggaaaccgcccgtcgctacgtggaaagtggcggtttcctgtggaactccggg
atgttctgtttcacggcctcgaccctggtcgacgagctggcgcagcatgccccggccctg
ctggagcaggccagggcctgcctggccgccagtgcggcggtgaagatggccgatggcatc
cagcatgagctggcgggcgaagccttcgccgcgctgccggacatttccatcgactatgcg
ctgatggagcgctccgcgcgggtcgccgtggtgccggcggccttcgactggagcgatatc
ggttcctggggcgcgatgagcgcgctgctcgacgcggacgcagagggcaatcgcggcagc
ggcgacaccctgttcgtcgacacccgtaacaccttcgtgcagagcgacgggcgcctggtc
gccacggtcggggtcgacgacctggtcgtggtggatacttccgatgcgctgctgatcgcc
cgcgccgaccgggtccaggaggtgcgcagggtggtgcagcggctgaaggacgagcggcac
gaggcctatcggctgcatcggaccgtcaaccgtccctggggcagctataccgtcctcgag
gaggggccgcgcttcaagatcaagcgaatcgtggtcaggccgggagagcgcttgtcgctg
cagatgcaccatcaccgcagcgagcactggatcgtggtgcaaggcatggccagggtcacc
aatggcgatggcgcgcggctggtcaacagcaacgagtcgacctacattcccgcgggccac
cggcatcgcctggaaaacccgggggtcatcgacctggtgatgatcgaggtgcagagcggc
gaatacctgggagaggacgacatcgtccgcttcgaggaccagtacggcagggtggtctga

DBGET integrated database retrieval system