KEGG   Pseudomonas aeruginosa c7447m: M802_2061Help
Entry
M802_2061         CDS       T03098                                 

Definition
(GenBank) 3-oxoacid CoA-transferase, B subunit
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
paec  Pseudomonas aeruginosa c7447m
Pathway
paec00072  Synthesis and degradation of ketone bodies
paec00280  Valine, leucine and isoleucine degradation
paec00650  Butanoate metabolism
paec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    M802_2061
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    M802_2061
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    M802_2061
Enzymes [BR:paec01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     M802_2061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Motif
Other DBs
NCBI-ProteinID: AGV65802
Position
2185468..2186124
Genome map
AA seq 218 aa AA seqDB search
MALTREQMAQRVARELKDGYYVNLGIGIPTLVANYVPEGIDVMLQSENGLLGMGAFPSEA
EVDADMINAGKQTVTARVGASIFDSAQSFAMIRGGHVDLTVLGAFEVDVRGNIASWMIPG
KLVKGMGGAMDLVAGAENIIVTMTHASKDGESKLLPYCTLPLTGCGCIRKVLTDLAYLEI
EDGAFILRERAPGVSVEEIVAKTAGKLIVPEHVPEMSF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggcacttacccgcgaacagatggcgcagcgcgtggcgcgcgaattgaaggacggctac
tacgtcaacctcggcatcggcatcccgaccctggtggccaactacgtgccggaaggcatc
gacgtcatgctccagtcggagaacggcctgctcggcatgggcgcgttccccagcgaggcg
gaagtcgacgccgacatgatcaacgccggcaagcagaccgtgaccgcccgcgtcggcgcg
tcgatcttcgactcggcgcagtccttcgccatgatccgtggcggccacgtcgacctcacc
gtgctcggtgccttcgaggtggacgtgcgcggcaacatcgcctcctggatgatccccggc
aagctggtcaagggcatgggcggcgccatggacctggtggccggcgccgagaacatcatc
gtcaccatgacccacgcctccaaggacggcgagtccaagctgctgccgtactgcaccctg
ccgctgaccggttgcggctgcattcgcaaggtgctcaccgacctggcctacctggagatc
gaggacggcgccttcatcctccgcgagcgcgcccccggggtcagcgtcgaggagatcgtg
gcgaagaccgccggcaagctgatcgtccccgagcacgtgccggaaatgagtttctga

DBGET integrated database retrieval system