KEGG   Pseudomonas aeruginosa c7447m: M802_2333Help
Entry
M802_2333         CDS       T03098                                 

Definition
(GenBank) D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain protein
  KO
K00032  phosphogluconate 2-dehydrogenase [EC:1.1.1.43]
Organism
paec  Pseudomonas aeruginosa c7447m
Pathway
paec00030  Pentose phosphate pathway
paec00480  Glutathione metabolism
paec01100  Metabolic pathways
paec01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:paec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    M802_2333
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    M802_2333
Enzymes [BR:paec01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.43  phosphogluconate 2-dehydrogenase
     M802_2333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AGV67458
Position
2491265..2492251
Genome map
AA seq 328 aa AA seqDB search
MKKVVLYKRLSAPLMERLRERVEVLLVEEPGRDDLARLRDALPEAHGLLGASLRLDAGLL
DLAPRLEAIASVSVGVDNYDIDYLDRRGILLSNTPDVLTETTADTGFALILATARRVVEL
AGWVRAGEWKKSVGAAQFGTDVHGKTLGIVGMGRIGEALARRGHHGFGMRVLYHSHSPKP
HVEERYAASYRPLDALLEESDFVCLTLPLTAATEGLIGAEQFARMRPQAIFINISRGRVV
DEAALIEALAQRRIRAAGLDVFEREPLSPDSPLLRLPNVVATPHIGSATEETREAMARCA
VDNLLAALAGERPLNLVNPSAWARRRGA
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagtggttctctacaaacgtctctccgcgcccctgatggaacgcctgcgcgaa
cgggtcgaggtgctcctggtcgaggagcccggccgcgacgacctggcccgcctgcgcgac
gccctgcccgaggcccacggcctgctcggcgccagcctgcgcctggacgccggactgctc
gacctggcaccgcgactggaagccatcgccagcgtctcggtgggcgtcgacaactatgac
atcgactacctcgaccgccgcggcatcctcctcagcaatacccccgacgtgctcaccgag
accaccgccgacaccggcttcgcgctgatcctggcgacagcccggcgggtagtggaactg
gccggctgggtgcgcgccggggaatggaagaagagcgtcggcgccgcccagttcggtacc
gacgtgcatggcaagaccctcggtatcgtcggcatgggccgcatcggcgaggccctggcc
cggcgcgggcaccacggcttcggcatgcgcgtgctgtaccacagccatagcccgaagccc
cacgtcgaagaacgctacgcagcgagctaccgccccctcgacgcgctgctcgaggaatcc
gacttcgtctgcctgaccctgccgctgaccgccgccaccgaaggcctgatcggtgccgag
cagttcgcccggatgcgcccgcaggcgatcttcatcaacatctcccgtggccgggtggtc
gacgaggcggccctgatcgaggccctggcccagcggcggatccgcgccgccggcctcgac
gtgttcgagcgcgagccgctgtctcccgactcgccgctgctgcgcctgccgaacgtggtg
gccactccgcacatcggctcggccaccgaggaaacccgcgaagccatggcccgctgcgcg
gtagacaacctgctggccgccctcgccggcgagcggccgctgaacctggtcaatccttcg
gcctgggcgcgacggcgaggcgcctga

DBGET integrated database retrieval system