KEGG   Pseudomonas aeruginosa c7447m: M802_3265Help
Entry
M802_3265         CDS       T03098                                 

Gene name
wlbB
Definition
(GenBank) lipopolysaccharides biosynthesis acetyltransferase
  KO
K13018  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase [EC:2.3.1.201]
Organism
paec  Pseudomonas aeruginosa c7447m
Pathway
paec00520  Amino sugar and nucleotide sugar metabolism
paec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    M802_3265 (wlbB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:paec01005]
    M802_3265 (wlbB)
Enzymes [BR:paec01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.201  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase
     M802_3265 (wlbB)
Lipopolysaccharide biosynthesis proteins [BR:paec01005]
 Unusual sugar
  M802_3265 (wlbB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep Hexapep_2 DUF4954
Motif
Other DBs
NCBI-ProteinID: AGV65702
Position
complement(3538638..3539213)
Genome map
AA seq 191 aa AA seqDB search
MSYYQHPSAIVDDGAQIGSDSRVWHFVHICAGARIGAGVSLGQNVFVGNKVVIGDRCKIQ
NNVSVYDNVTLEEGVFCGPSMVFTNVYNPRSLIERKDQYRNTLVKKGATLGANCTIVCGV
TIGEYAFVGAGAVINKNVPSYALMVGVPARQIGWMSEFGEQLQLNEQGEAVCSHSGARYV
LNGKILSKVDV
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgagttattatcagcaccccagcgcgatcgtcgacgacggtgcgcagatcggtagcgac
tcccgagtttggcacttcgtgcacatctgtgcaggtgcccggattggcgcaggggtttcg
ttgggtcagaacgtattcgtcggcaacaaggtcgttattggtgatcgctgcaagatccag
aacaacgtgtcggtatatgacaatgtcactctcgaagagggcgtgttctgcgggccgagc
atggtatttaccaacgtttacaacccccgctcgttgatcgagcgcaaggatcagtaccgt
aacacgttggtaaaaaaaggtgccacgcttggtgccaactgcactatcgtctgtggcgtg
actattggtgaatatgccttcgtgggtgcgggtgcggtcattaacaagaatgttccatct
tatgccctgatggtaggcgtgcccgctcgacagattggttggatgagcgaattcggtgag
cagctgcagctgaacgagcagggcgaagctgtctgctcacactccggtgcgcgctatgta
ctcaatggaaagatcctgagcaaggtggacgtgtga

DBGET integrated database retrieval system