KEGG   Pseudomonas aeruginosa c7447m: M802_4627Help
Entry
M802_4627         CDS       T03098                                 

Gene name
gatA
Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, A subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
paec  Pseudomonas aeruginosa c7447m
Pathway
paec00970  Aminoacyl-tRNA biosynthesis
paec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paec00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    M802_4627 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:paec03029]
    M802_4627 (gatA)
Enzymes [BR:paec01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     M802_4627 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     M802_4627 (gatA)
Mitochondrial biogenesis [BR:paec03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    M802_4627 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AGV66684
Structure
PDB: 

Position
5011776..5013230
Genome map
AA seq 484 aa AA seqDB search
MLHQLTLAEIARALADKQFSAEELTRTLLGRIRQLDPQLNSFISITDDLAIAQAKAADER
RANGENGALLGAPIAHKDLFCTQGVRTSCGSKMLDNFVSPYDATVVEKLTAAGAVTLGKL
NMDEFAMGSSNQSSHYGAVNNPWSLDRVPGGSSGGSAAAVAARLLPAATGTDTGGSIRQP
AALTNLTGIKPTYGRVSRWGMIAYASSLDQGGPLARTAEDCALMLGVMAGFDPKDSTSVE
QPVDDYLAALQKPLSGLRIGLPREYFGAGLDSRIADAVLAVVEELKTLGATVKDISLPNM
QHAIPAYYVIAPAEASSNLSRFDGVRYGYRCDAPQNLEDLYKRSRAEGFGSEVKNRIMVG
TYALSAGYYDAYYLQAQKIRRLIKNDFVSAFAEVDVILGPTTPNPAWKIGEKNDDPVSQY
LEDIYTITANLAGLPGLSMPAGFVDGLPVGVQLLAPYFQEGRLLNVAHQYQQVSDWHTRT
PAGF
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgctgcatcaattgaccctcgccgagatcgcccgcgccctcgccgacaagcaattttcc
gccgaagagctgacccgcaccctgctcggtcgcatccggcagctggatccccagctcaac
agtttcatcagcatcaccgacgacctggccattgcccaggccaaggcagccgacgaacgg
cgcgccaacggcgagaacggcgccctgctcggcgcgccgatcgcccacaaggacctgttc
tgcacccagggcgtacgcaccagctgcggttcgaagatgctcgacaacttcgtctcgccc
tacgacgccaccgtggtcgagaagctcaccgccgccggcgccgttaccctcggcaagctg
aacatggatgaattcgccatgggctcgtcgaaccagtccagccactacggcgcggtgaac
aacccctggagcctcgaccgcgtgccgggcggctcctccggcggttccgccgcggcagtc
gccgcgcgcctgctgccggccgccaccggcaccgataccggcggctcgatccgccaaccg
gcggcgctgaccaacctcaccgggatcaagccaacctacggccgggtttcccgctggggc
atgatcgcctacgcctccagcctcgaccagggcggcccgctggcgcgcaccgccgaggac
tgcgcgctgatgctgggggtgatggccggattcgatccgaaggactcgaccagcgtcgaa
cagccggtggacgactacctggccgccctgcagaagccgcttagcggcctgcgcatcggc
ctgccgcgggaatacttcggcgccggcctcgacagccgcatcgccgacgcggtgctggcc
gtggtcgaggagctgaagacgctcggcgccacggtgaaggacatttccctgccgaacatg
cagcacgccatcccggcctactacgtgatcgcgccggccgaggcgtcctccaacctgtcg
cgcttcgacggcgtgcgctatggctatcgttgcgacgccccgcagaacctggaagacctg
tacaagcgctcgcgcgcggaaggcttcggcagcgaagtgaagaaccgcatcatggtcggc
acctacgcactgtcggccggctactacgatgcctattacctgcaggctcagaagattcgc
cggctgatcaagaacgacttcgtcagcgcctttgccgaagtggacgtgatcctcggcccg
accacgccgaacccggcctggaagatcggcgagaagaacgacgacccggtttcccagtac
ctggaagacatctacaccatcaccgccaacctcgccggcctgccggggctgtccatgccc
gccggcttcgtcgacggcctgccggtgggtgtccagttgctcgcgccctacttccaggaa
ggccgcctgctcaacgtcgcgcaccagtaccagcaggtcagcgactggcacacccgcacc
ccggccggcttctaa

DBGET integrated database retrieval system