KEGG   Pseudomonas aeruginosa c7447m: M802_4736Help
Entry
M802_4736         CDS       T03098                                 

Gene name
ccpA
Definition
(GenBank) cytochrome c551 peroxidase
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
paec  Pseudomonas aeruginosa c7447m
Brite
KEGG Orthology (KO) [BR:paec00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    M802_4736 (ccpA)
Enzymes [BR:paec01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     M802_4736 (ccpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCP_MauG Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: AGV67276
Structure
PDB: 

Position
5134119..5135159
Genome map
AA seq 346 aa AA seqDB search
MQSSQLLPLGSLLLSFATPLAQADALHDQARALFKPIPEQVTELRGQPISEQQRELGKKL
FFDPRLSRSHVLSCNTCHNVGTGGADNVPTSVGHGWQKGPRNSPTVFNAVFNAAQFWDGR
AKDLGEQAKGPIQNSVEMHSTPQLVEQTLGSIPEYVDAFRKAFPKAGKPVSFDNMALAIE
AYEATLVTPDSPFDLYLKGDDKALDAQQKKGLKAFMDSGCSACHNGINLGGQAYFPFGLV
KKPDASVLPSGDKGRFAVTKTQSDEYVFRAAPLRNVALTAPYFHSGQVWELKDAVAIMGN
AQLGKQLAPDDVENIVAFLHSLSGKQPRVEYPLLPASTETTPRPAE
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcctcgcaactgctcccgcttggcagcctgttgctgtcgttcgccacgcccctc
gcccaggccgatgccctgcacgaccaggcccgcgcgctgttcaaacccatccccgagcag
gtcaccgagctacgcggccagcccatcagcgagcaacagcgcgaactcggcaagaaactg
ttcttcgacccgcgcctgtcacgcagccatgtgctcagctgcaacacctgccacaacgtc
ggcaccggcggcgccgacaacgtaccgacgtcggtcggtcacggctggcagaaggggcca
cgcaattcaccgacggtcttcaacgccgtgttcaatgccgcgcagttctgggatggccgt
gccaaggacctgggggagcaggccaagggtccgatccagaacagcgtcgagatgcacagt
accccgcagttggtcgaacagaccctgggcagcatcccggaatacgtggacgccttccgc
aaggccttccccaaggccggcaagccggtcagcttcgacaacatggcgctggccatcgag
gcctacgaggcgaccctggtgactccggactcgcccttcgacctgtatctcaagggcgac
gacaaggccctcgacgcacagcagaagaaaggcctcaaggcattcatggacagtggctgc
agcgcctgccacaacggcatcaacctgggcggccaggcctacttcccgttcggcctggtg
aagaagcccgacgccagcgtgctgcccagcggcgacaagggccgcttcgccgtgaccaag
acccagagcgacgagtacgtattccgcgccgcgcccctgcgcaacgtcgccctcaccgcg
ccgtacttccacagcggccaggtctgggaactcaaggacgcggtggcgatcatgggcaac
gcccagctcggcaagcagttggcgccggacgacgtggagaacatcgtcgccttcctgcac
agcctgagcggcaagcagccgcgcgtcgaatatccgctgctgccggccagcacggagacc
acgccgcgtcccgcggaataa

DBGET integrated database retrieval system